Products

View as table Download

YTHDC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human YTHDC1 (NP_001026902.1).
Modifications Unmodified

YTHDC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human YTHDC1 (NP_001026902.1).
Modifications Unmodified

Rabbit Polyclonal Anti-YTHDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YTHDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human YTHDC1. Synthetic peptide located within the following region: GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR