Products

cDNA Clones (32)
RNAi (13)
Gene Expression (6)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
YTHDC1 (NM_001031732) Human Tagged ORF Clone Lentiviral Particle
RC207931L1V

USD 820.00

7 Weeks

Lenti ORF particles, YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
YTHDC1 (NM_001031732) Human Tagged ORF Clone Lentiviral Particle
RC207931L2V

USD 820.00

3 Weeks

Lenti ORF particles, YTHDC1 (mGFP-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Ythdc1 (NM_177680) Mouse Tagged ORF Clone
MR214240

USD 610.00

In Stock

Ythdc1 (Myc-DDK-tagged) - Mouse YTH domain containing 1 (Ythdc1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
YTHDC1 (NM_001031732) Human Tagged ORF Clone
RC207931

USD 420.00

In Stock

YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
YTHDC1 (NM_133370) Human Tagged ORF Clone
RC208796

USD 420.00

In Stock

YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2. Note: ORF is codon optimized

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
YTHDC1 Human Gene Knockout Kit (CRISPR)
KN407931

USD 1,290.00

2 Weeks

YTHDC1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407931 is the updated version of KN207931.
Ythdc1 Mouse Gene Knockout Kit (CRISPR)
KN519566

USD 1,290.00

2 Weeks

Ythdc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN519566 is the updated version of KN319566.
Ythdc1 (NM_177680) Mouse Tagged ORF Clone
MG214240

USD 670.00

3 Weeks

Ythdc1 (GFP-tagged) - Mouse YTH domain containing 1 (Ythdc1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ythdc1 (NM_177680) Mouse Tagged ORF Clone
MR214240L3

USD 810.00

3 Weeks

Lenti ORF clone of Ythdc1 (Myc-DDK-tagged) - Mouse YTH domain containing 1 (Ythdc1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ythdc1 (NM_177680) Mouse Tagged ORF Clone
MR214240L4

USD 810.00

3 Weeks

Lenti ORF clone of Ythdc1 (mGFP-tagged) - Mouse YTH domain containing 1 (Ythdc1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_001031732) Human Tagged ORF Clone
RC207931L3

USD 620.00

3 Weeks

Lenti-ORF clone of YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_001031732) Human Tagged ORF Clone Lentiviral Particle
RC207931L4V

USD 820.00

3 Weeks

Lenti ORF particles, YTHDC1 (mGFP-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_133370) Human Tagged ORF Clone
RC208796L3

USD 620.00

3 Weeks

Lenti-ORF clone of YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2. Note: ORF is codon optimized

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_133370) Human Tagged ORF Clone Lentiviral Particle
RC208796L3V

USD 820.00

6 Weeks

Lenti ORF particles, YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2, 200ul, >10^7 TU/mL. Note: ORF is codon optimized

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_133370) Human Tagged ORF Clone
RC208796L4

USD 620.00

3 Weeks

Lenti-ORF clone of YTHDC1 (mGFP-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2. Note: ORF is codon optimized

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_133370) Human Tagged ORF Clone Lentiviral Particle
RC208796L4V

USD 820.00

6 Weeks

Lenti ORF particles, YTHDC1 (mGFP-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2, 200ul, >10^7 TU/mL. Note: ORF is codon optimized

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_001031732) Human Tagged ORF Clone
RG207931

USD 460.00

3 Weeks

YTHDC1 (GFP-tagged) - Human YTH domain containing 1 (YTHDC1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
YTHDC1 (NM_133370) Human Tagged ORF Clone
RG208796

USD 460.00

3 Weeks

YTHDC1 (GFP-tagged) - Human YTH domain containing 1 (YTHDC1), transcript variant 2. Note: ORF is codon optimized

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ythdc1 (NM_133423) Rat Tagged ORF Clone
RR203298

USD 1,000.00

5 Weeks

Ythdc1 (Myc-DDK-tagged ORF) - Rat splicing factor YT521-B (Yt521), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ythdc1 (NM_133423) Rat Tagged ORF Clone
RR203298L3

USD 1,180.00

12 Weeks

Lenti ORF clone of Ythdc1 (Myc-DDK-tagged ORF) - Rat splicing factor YT521-B (Yt521), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ythdc1 (NM_133423) Rat Tagged ORF Clone Lentiviral Particle
RR203298L3V

USD 1,410.00

16 Weeks

Lenti ORF particles, Ythdc1 (Myc-DDK-tagged ORF) - Rat splicing factor YT521-B (Yt521), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ythdc1 (NM_133423) Rat Tagged ORF Clone
RR203298L4

USD 1,300.00

12 Weeks

Lenti ORF clone of Ythdc1 (mGFP-tagged ORF) - Rat splicing factor YT521-B (Yt521), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ythdc1 (NM_133423) Rat Tagged ORF Clone Lentiviral Particle
RR203298L4V

USD 1,570.00

16 Weeks

Lenti ORF particles, Ythdc1 (GFP-tagged ORF) - Rat splicing factor YT521-B (Yt521), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
YTHDC1 (NM_001031732) Human Tagged Lenti ORF Clone
RC207931L2

USD 768.00

In Stock

Lenti-ORF clone of YTHDC1 (mGFP-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
YTHDC1 Rabbit Polyclonal Antibody
TA383416

USD 275.00

3 Weeks

YTHDC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human YTHDC1 (NP_001026902.1).
Modifications Unmodified
YTHDC1 Rabbit Polyclonal Antibody
TA383416S

USD 85.00

3 Weeks

YTHDC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human YTHDC1 (NP_001026902.1).
Modifications Unmodified
YTHDC1 Human siRNA Oligo Duplex (Locus ID 91746)
SR314128

USD 430.00

In Stock

YTHDC1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

YTHDC1 (NM_001031732) Human Tagged ORF Clone
RC207931L1

USD 620.00

3 Weeks

Lenti-ORF clone of YTHDC1 (Myc-DDK-tagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
YTHDC1 (NM_001031732) Human Untagged Clone
SC324231

USD 760.00

In Stock

YTHDC1 (untagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
YTHDC1 Rabbit Polyclonal Antibody
TA337926

USD 375.00

5 Days

Rabbit Polyclonal Anti-YTHDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YTHDC1 antibody is: synthetic peptide directed towards the N-terminal region of Human YTHDC1. Synthetic peptide located within the following region: GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR
YTHDC1 Human shRNA Plasmid Kit (Locus ID 91746)
TF308326

USD 715.00

2 Weeks

YTHDC1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
Human YTHDC1 activation kit by CRISPRa
GA114147

USD 1,290.00

2 Weeks

YTHDC1 CRISPRa kit - CRISPR gene activation of human YTH domain containing 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Ythdc1 activation kit by CRISPRa
GA214255

USD 1,290.00

2 Weeks

Ythdc1 CRISPRa kit - CRISPR gene activation of mouse YTH domain containing 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
YTHDC1 Human qPCR Primer Pair (NM_133370)
HP230291

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene YTHDC1

Ythdc1 (NM_177680) Mouse Untagged Clone
MC221199

USD 1,000.00

5 Weeks

Ythdc1 (untagged) - Mouse YTH domain containing 1 (Ythdc1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Ythdc1 Mouse qPCR Primer Pair (NM_177680)
MP218653

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Ythdc1

Ythdc1 (NM_133423) Rat Untagged Clone
RN203298

USD 1,000.00

6 Weeks

Ythdc1 (untagged ORF) - Rat splicing factor YT521-B (Yt521), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
YTHDC1 (NM_133370) Human Untagged Clone
SC111488

USD 760.00

7 Weeks

YTHDC1 (untagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
YTHDC1 (NM_133370) Human Untagged Clone
SC318191

USD 760.00

5 Weeks

YTHDC1 (untagged)-Human YTH domain containing 1 (YTHDC1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
Ythdc1 Mouse siRNA Oligo Duplex (Locus ID 231386)
SR419681

USD 430.00

2 Weeks

Ythdc1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Ythdc1 Rat siRNA Oligo Duplex (Locus ID 170956)
SR503012

USD 430.00

2 Weeks

Ythdc1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

YTHDC1 (NM_001031732) ICC Control Block
TB407931

USD 1,070.00

4 Weeks

Transient overexpression of YTHDC1 (NM_001031732) in HEK293T cells paraffin embedded controls for ICC/IHC staining

YTHDC1 (NM_133370) ICC Control Block
TB408796

USD 1,070.00

4 Weeks

Transient overexpression of YTHDC1 (NM_133370) in HEK293T cells paraffin embedded controls for ICC/IHC staining

YTHDC1 Human shRNA Plasmid Kit (Locus ID 91746)
TL308326

USD 815.00

2 Weeks

YTHDC1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
YTHDC1 Human shRNA Lentiviral Particle (Locus ID 91746)
TL308326V

USD 1,395.00

5 Weeks

YTHDC1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Ythdc1 Mouse shRNA Plasmid (Locus ID 231386)
TL519801

USD 815.00

2 Weeks

Ythdc1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti