Products

Jump to Filters
View as table Download
AKR1C1 Rabbit Polyclonal Antibody
TA342867

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKR1C1 Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL