Germany
Japan
United Kingdom
China
Products
Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Anti-SNX9 mouse mAb, clone OTI2F1, PE conjugated
| Applications | FC |
| Reactivities | Human, Monkey |
| Conjugation | PE |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Calbindin (CALB1) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Human, Monkey, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
USD 420.00
In Stock
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Active filters
Reactivities
- Monkey
Filter by
Target Symbol
- MAP2K1 (150)
- TP53 (86)
- MAP2K3 (85)
- CTNNB1 (83)
- IGF2BP2 (51)
- CCDC93 (40)
- MAPK1 (40)
- SNX9 (36)
- AKT1 (35)
- DNAJA2 (35)
- EPN2 (35)
- PARVA (35)
- UBE2G2 (35)
- HSPA1A (33)
- ACAA2 (30)
- BRAF (30)
- DSTN (30)
- NONO (30)
- PACSIN3 (30)
- PRKCE (30)
- PSMB7 (30)
- TRIM38 (30)
- TXNDC5 (30)
- ZSCAN21 (30)
- HSPD1 (28)
- ATP5F1B (26)
- ACAT2 (25)
- ARFGAP1 (25)
- CLPP (25)
- DDX39B (25)
- HDAC6 (25)
- NRBP1 (25)
- SAMHD1 (25)
- SENP2 (25)
- SERPINB1 (25)
- SPR (25)
- SSB (25)
- VBP1 (25)
- CD4 (23)
- PSMA6 (23)
- EIF2S1 (21)
- AK4 (20)
- BCAR1 (20)
- EPHX1 (20)
- HRAS (20)
- LEMD3 (20)
- LMAN1 (20)
- MAPK13 (20)
- MSI1 (20)
- NLN (20)
- PGAM2 (20)
- PIK3R5 (20)
- PUS7 (20)
- RAB21 (20)
- SERPINA1 (20)
- USP5 (20)
- BUB1B (18)
- KRT8 (18)
- AK1 (16)
- ERCC4 (16)
- HSPB1 (16)
- PSMA4 (16)
- ATG3 (15)
- BECN1 (15)
- CALCOCO2 (15)
- CBWD1 (15)
- CDK2 (15)
- CHEK2 (15)
- DNAAF1 (15)
- DPP9 (15)
- DTNB (15)
- FBXO21 (15)
- FERMT2 (15)
- FMR1 (15)
- GOLM1 (15)
- GPHN (15)
- GTF3C4 (15)
- ILVBL (15)
- KLK8 (15)
- LZIC (15)
- MAPK9 (15)
- MAPRE2 (15)
- NHEJ1 (15)
- NQO2 (15)
- NUDT6 (15)
- NXNL2 (15)
- PFKP (15)
- PPP5C (15)
- PRKD2 (15)
- PSMA2 (15)
- PSMB9 (15)
- RNF113B (15)
- RPA2 (15)
- RUVBL2 (15)
- SCFD1 (15)
- SERBP1 (15)
- SIGLEC9 (15)
- SMS (15)
- SNTA1 (15)
- SQSTM1 (15)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
- Unmodified (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (6)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (3)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- Phospho-specific (2)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric mouse antibody, based on the original rat IgG2b format, created for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (3247)
- Transmembrane (746)
- Transcription Factors (619)
- Protein Kinase (589)
- ES Cell Differentiation/IPS (370)
- Protease (370)
- Stem cell - Pluripotency (352)
- Secreted Protein (162)
- GPCR (109)
- Adult stem cells (51)
- Induced pluripotent stem cells (30)
- Stem cell relevant signaling - DSL/Notch pathway (28)
- Cancer stem cells (22)
- Phosphatase (19)
- Stem cell relevant signaling - JAK/STAT signaling pathway (17)
- Ion Channels: Potassium (16)
- P450 (15)
- Embryonic stem cells (13)
- Nuclear Hormone Receptor (12)
- Ion Channels: Transient receptor potential (9)
- Ion Channels: Other (7)
- Stem cell relevant signaling - Wnt Signaling pathway (7)
- Ion Channels: ATP Receptors (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- Ion Channels: Calcium (1)
- Ion Channels: Sodium (1)
Pathways
- Pathways in cancer (637)
- Metabolic pathways (598)
- MAPK signaling pathway (596)
- Prostate cancer (526)
- Focal adhesion (517)
- Endometrial cancer (502)
- Colorectal cancer (496)
- Neurotrophin signaling pathway (469)
- Fc epsilon RI signaling pathway (452)
- Toll-like receptor signaling pathway (438)
- Chronic myeloid leukemia (430)
- Thyroid cancer (427)
- Pancreatic cancer (419)
- Non-small cell lung cancer (415)
- Melanoma (412)
- Glioma (411)
- Insulin signaling pathway (380)
- T cell receptor signaling pathway (379)
- Progesterone-mediated oocyte maturation (376)
- ErbB signaling pathway (371)
- GnRH signaling pathway (361)
- Bladder cancer (358)
- Chemokine signaling pathway (357)
- Regulation of actin cytoskeleton (350)
- Renal cell carcinoma (344)
- Acute myeloid leukemia (342)
- VEGF signaling pathway (342)
- Fc gamma R-mediated phagocytosis (329)
- Melanogenesis (326)
- B cell receptor signaling pathway (325)
- Natural killer cell mediated cytotoxicity (305)
- Gap junction (289)
- Vascular smooth muscle contraction (279)
- Long-term depression (259)
- Long-term potentiation (259)
- Prion diseases (254)
- Wnt signaling pathway (235)
- Oocyte meiosis (227)
- Amyotrophic lateral sclerosis (ALS) (219)
- Dorso-ventral axis formation (200)
- Apoptosis (191)
- Basal cell carcinoma (188)
- Huntington's disease (184)
- Tight junction (183)
- Leukocyte transendothelial migration (179)
- Small cell lung cancer (172)
- Cell cycle (170)
- Endocytosis (162)
- Pathogenic Escherichia coli infection (161)
- Adherens junction (159)
- mTOR signaling pathway (157)
- Alzheimer's disease (147)
- p53 signaling pathway (131)
- Type II diabetes mellitus (129)
- Proteasome (119)
- Parkinson's disease (115)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (107)
- Valine (106)
- leucine and isoleucine degradation (106)
- Ubiquitin mediated proteolysis (102)
- NOD-like receptor signaling pathway (98)
- Jak-STAT signaling pathway (97)
- Purine metabolism (95)
- Glycolysis / Gluconeogenesis (94)
- Cell adhesion molecules (CAMs) (93)
- Axon guidance (89)
- Fatty acid metabolism (81)
- Antigen processing and presentation (80)
- Neuroactive ligand-receptor interaction (76)
- Oxidative phosphorylation (69)
- Hematopoietic cell lineage (68)
- Nucleotide excision repair (67)
- Adipocytokine signaling pathway (64)
- Epithelial cell signaling in Helicobacter pylori infection (59)
- Spliceosome (58)
- TGF-beta signaling pathway (57)
- Pyruvate metabolism (54)
- Arginine and proline metabolism (51)
- Calcium signaling pathway (51)
- Tryptophan metabolism (49)
- Systemic lupus erythematosus (47)
- Butanoate metabolism (46)
- Propanoate metabolism (46)
- RIG-I-like receptor signaling pathway (46)
- RNA degradation (45)
- Histidine metabolism (43)
- Phosphatidylinositol signaling system (42)
- Type I diabetes mellitus (42)
- Complement and coagulation cascades (41)
- Lysine degradation (41)
- beta-Alanine metabolism (41)
- Fatty acid elongation in mitochondria (40)
- Glutathione metabolism (39)
- Lysosome (38)
- Metabolism of xenobiotics by cytochrome P450 (38)
- Primary immunodeficiency (36)
- One carbon pool by folate (35)
- Regulation of autophagy (35)
- Alanine (33)
- DNA replication (33)
- aspartate and glutamate metabolism (33)
- Mismatch repair (32)
- Pyrimidine metabolism (32)
- Vibrio cholerae infection (32)
- Cytokine-cytokine receptor interaction (31)
- Pentose phosphate pathway (31)
- Base excision repair (30)
- Folate biosynthesis (30)
- Galactose metabolism (30)
- Terpenoid backbone biosynthesis (30)
- Cysteine and methionine metabolism (29)
- Hypertrophic cardiomyopathy (HCM) (27)
- Amino sugar and nucleotide sugar metabolism (26)
- Renin-angiotensin system (26)
- Synthesis and degradation of ketone bodies (25)
- Citrate cycle (TCA cycle) (24)
- Tyrosine metabolism (24)
- Arachidonic acid metabolism (23)
- Hedgehog signaling pathway (23)
- Homologous recombination (23)
- Viral myocarditis (23)
- Drug metabolism - cytochrome P450 (22)
- Glycerolipid metabolism (22)
- Dilated cardiomyopathy (21)
- Glycine (21)
- serine and threonine metabolism (21)
- Cardiac muscle contraction (20)
- Non-homologous end-joining (19)
- Fructose and mannose metabolism (17)
- Selenoamino acid metabolism (17)
- Notch signaling pathway (16)
- Retinol metabolism (16)
- Glycosaminoglycan degradation (15)
- Starch and sucrose metabolism (14)
- Basal transcription factors (13)
- Allograft rejection (12)
- Sphingolipid metabolism (12)
- Androgen and estrogen metabolism (11)
- Ascorbate and aldarate metabolism (11)
- Glycerophospholipid metabolism (11)
- Inositol phosphate metabolism (11)
- Limonene and pinene degradation (11)
- Methane metabolism (11)
- N-Glycan biosynthesis (11)
- Nitrogen metabolism (11)
- Autoimmune thyroid disease (10)
- Glycosphingolipid biosynthesis - ganglio series (10)
- Other glycan degradation (10)
- PPAR signaling pathway (10)
- RNA polymerase (10)
- Graft-versus-host disease (8)
- Maturity onset diabetes of the young (8)
- Pantothenate and CoA biosynthesis (8)
- Phenylalanine metabolism (8)
- Caffeine metabolism (7)
- Drug metabolism - other enzymes (7)
- ECM-receptor interaction (7)
- Asthma (6)
- Linoleic acid metabolism (6)
- SNARE interactions in vesicular transport (6)
- Aminoacyl-tRNA biosynthesis (5)
- Biosynthesis of unsaturated fatty acids (5)
- C21-Steroid hormone metabolism (5)
- Cytosolic DNA-sensing pathway (5)
- Glyoxylate and dicarboxylate metabolism (5)
- Keratan sulfate biosynthesis (5)
- Ribosome (5)
- Steroid biosynthesis (5)
- Sulfur metabolism (5)
- Taurine and hypotaurine metabolism (5)
- Vitamin B6 metabolism (5)
- Nicotinate and nicotinamide metabolism (4)
- Taste transduction (4)
- Riboflavin metabolism (3)
- ABC transporters (2)
- Olfactory transduction (2)
- Phenylalanine (2)
- tyrosine and tryptophan biosynthesis (2)
- D-Glutamine and D-glutamate metabolism (1)
- Ether lipid metabolism (1)
- O-Glycan biosynthesis (1)
- alpha-Linolenic acid metabolism (1)