Products

View as table Download

Rabbit Polyclonal BFAR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BFAR antibody was raised against a 14 amino acid peptide near the carboxy terminus of human BFAR.

Rabbit Polyclonal Anti-BFAR Antibody

Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bfar antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL

BFAR Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human BFAR (NP_057645.1).
Modifications Unmodified