Products

View as table Download

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP

GDF5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GDF5 (NP_000548.2).
Modifications Unmodified

GDF5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-501 of human GDF5 (NP_000548.2).
Modifications Unmodified