Products

View as table Download

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA8

Rabbit polyclonal HSPA8 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HSPA8.

Mouse monoclonal anti-HSPA8(HSC70) antibody, clone 1F2-H5, Loading control

Applications WB
Reactivities Human, Mouse, Rat. Not yet tested in other species
Conjugation Unconjugated

Mouse Monoclonal anti-HSPA8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal anti-Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HSPA8 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse HSPA8

Hsc70/HSPA8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Hsc70/HSPA8 (NP_006588.1).
Modifications Unmodified

Hsc70 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Hsc70

Hsc70 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Hamster, Human, Mouse, Rat
Conjugation Unconjugated

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated