Germany
Japan
United Kingdom
China
HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 1,092.00
5 Weeks
Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (Hspa8)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Lenti ORF particles, HSPA8 (mGFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hspa8 (Myc-DDK-tagged ORF) - Rat heat shock protein 8 (Hspa8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hspa8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508007 is the updated version of KN308007.
Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:11684 IMAGE:3711399)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hspa8 (mGFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (Hspa8)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (Hspa8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hspa8 (mGFP-tagged) - Mouse heat shock protein 8 (Hspa8)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (Hspa8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA8 (mGFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Hspa8 (Myc-DDK-tagged ORF) - Rat heat shock protein 8 (Hspa8), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hspa8 (Myc-DDK-tagged ORF) - Rat heat shock protein 8 (Hspa8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hspa8 (mGFP-tagged ORF) - Rat heat shock protein 8 (Hspa8), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hspa8 (GFP-tagged ORF) - Rat heat shock protein 8 (Hspa8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Hspa8 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
HSPA8 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Hspa8 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Hspa8 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Hspa8 (untagged) - Mouse heat shock protein 8 (Hspa8), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HSPA8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320564 is the updated version of SR302258.
HSPA8 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
HSPA8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Active filters
Target Symbol
- HSPA8