Products

View as table Download

HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (Hspa8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Hspa8 (Myc-DDK-tagged ORF) - Rat heat shock protein 8 (Hspa8), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Hspa8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN508007 is the updated version of KN308007.

Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:11684 IMAGE:3711399)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Hspa8 (mGFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Hspa8 (GFP-tagged) - Mouse heat shock protein 8 (cDNA clone MGC:102008 IMAGE:30540914), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Hspa8 (Myc-DDK-tagged) - Mouse heat shock protein 8 (Hspa8)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Hspa8 (mGFP-tagged) - Mouse heat shock protein 8 (Hspa8)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Hspa8 (Myc-DDK-tagged ORF) - Rat heat shock protein 8 (Hspa8), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Hspa8 (Myc-DDK-tagged ORF) - Rat heat shock protein 8 (Hspa8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Hspa8 (mGFP-tagged ORF) - Rat heat shock protein 8 (Hspa8), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Hspa8 (GFP-tagged ORF) - Rat heat shock protein 8 (Hspa8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Hspa8 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

HSPA8 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

Hspa8 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin

Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

Hspa8 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Hspa8 (untagged) - Mouse heat shock protein 8 (Hspa8), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA8

HSPA8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR320564 is the updated version of SR302258.

HSPA8 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

HSPA8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin

Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®