Products

View as table Download

Rabbit Polyclonal Anti-ORC2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Orc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Orc2. Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV

Rabbit polyclonal antibody to ORC2 (origin recognition complex, subunit 2-like (yeast))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 208 and 479 of ORC2 (Uniprot ID#Q13416)

ORC2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ORC2

ORC2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ORC2