Germany
Japan
United Kingdom
China
ORC2 (Myc-DDK-tagged)-Human origin recognition complex, subunit 2 (ORC2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ORC2 (Myc-DDK tagged) - Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ORC2 (mGFP-tagged) - Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ORC2 (GFP-tagged) - Human origin recognition complex, subunit 2 (ORC2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human origin recognition complex, subunit 2-like (yeast) (ORC2L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Orc2 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant a
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Orc2 (myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant c
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ORC2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401599 is the updated version of KN201599.
Orc2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN512625 is the updated version of KN312625.
Orc2 (GFP-tagged) - Mouse origin recognition complex subunit 2-like (S. cerevisiae) (Orc2l) transcript variant b, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Orc2 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant a
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Orc2 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Orc2 (mGFP-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant a
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Orc2 (GFP-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant a, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Orc2 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant b
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Orc2 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant b
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Orc2 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Orc2 (mGFP-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant b
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Orc2 (GFP-tagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant b, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ORC2 (Myc-DDK tagged) - Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ORC2 (mGFP-tagged) - Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Orc2 (Myc-DDK-tagged ORF) - Rat origin recognition complex, subunit 2-like (yeast) (Orc2l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Orc2 (Myc-DDK-tagged ORF) - Rat origin recognition complex, subunit 2-like (yeast) (Orc2l), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Orc2 (Myc-DDK-tagged ORF) - Rat origin recognition complex, subunit 2-like (yeast) (Orc2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Orc2 (mGFP-tagged ORF) - Rat origin recognition complex, subunit 2-like (yeast) (Orc2l), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Orc2 (GFP-tagged ORF) - Rat origin recognition complex, subunit 2-like (yeast) (Orc2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ORC2 (untagged)-Human origin recognition complex, subunit 2 (ORC2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ORC2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Orc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Orc2. Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV |
Lenti ORF clone of Human origin recognition complex, subunit 2 (ORC2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ORC2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ORC2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of origin recognition complex, subunit 2-like (yeast) (ORC2L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Orc2 (untagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant a, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal ORC2L Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ORC2L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 208-237 amino acids from the Central region of human ORC2L. |
Mouse Monoclonal ORC2 Antibody
| Applications | WB |
| Reactivities | Human |
ORC2 CRISPRa kit - CRISPR gene activation of human origin recognition complex subunit 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Orc2 CRISPRa kit - CRISPR gene activation of mouse origin recognition complex, subunit 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ORC2L
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ORC2L
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Orc2 (untagged) - Mouse origin recognition complex, subunit 2 (Orc2), transcript variant c
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Orc2l
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Orc2l
ORC2L MS Standard C13 and N15-labeled recombinant protein (NP_006181)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Orc2 (untagged ORF) - Rat origin recognition complex, subunit 2-like (yeast) (Orc2l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of origin recognition complex subunit 2-like (yeast) (ORC2L) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Orc2l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Active filters
Target Symbol
- ORC2