Rabbit anti-KLKB1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLKB1 |
Rabbit anti-KLKB1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLKB1 |
Rabbit Polyclonal Anti-Klkb1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Klkb1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK |
KLKB1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human KLKB1 (NP_000883.2). |
Modifications | Unmodified |