XDH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XDH |
XDH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XDH |
Xanthine Oxidase (XDH) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2). |
Modifications | Unmodified |
Xanthine Oxidase (XDH) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Xanthine Oxidase (Xanthine Oxidase (XDH)) (NP_000370.2). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-XDH Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XDH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human XDH |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI5D8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI5D8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
XDH mouse monoclonal antibody,clone OTI1C10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
XDH mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |