Products

View as table Download

Goat Polyclonal Antibody against ABCC8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2.

Rabbit Polyclonal Anti-ABCC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW

Mouse Monoclonal Anti-SUR1 Antibody

Reactivities Hamster, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ABCC8 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC8

ABCC8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC8

ABCC8 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-1000 of human ABCC8 (NP_000343.2).
Modifications Unmodified