Rabbit Polyclonal Anti-CGI Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CGI-143 antibody: synthetic peptide directed towards the N terminal of human CGI-143. Synthetic peptide located within the following region: AGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVV |
Rabbit Polyclonal Anti-Bola1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE |
BOLA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
