Germany
Japan
United Kingdom
China
Recombinant protein of human bolA homolog 1 (E. coli) (BOLA1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Products
View as table Download
Bola1 (Myc-DDK-tagged) - Mouse bolA-like 1 (E. coli) (Bola1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BOLA1 (Myc-DDK-tagged)-Human bolA homolog 1 (E. coli) (BOLA1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
BOLA1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409532 is the updated version of KN209532.
Bola1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502221 is the updated version of KN302221.
Bola1 (GFP-tagged) - Mouse bolA-like 1 (E. coli) (Bola1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bola1 (Myc-DDK-tagged) - Mouse bolA-like 1 (E. coli) (Bola1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bola1 (Myc-DDK-tagged) - Mouse bolA-like 1 (E. coli) (Bola1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bola1 (mGFP-tagged) - Mouse bolA-like 1 (E. coli) (Bola1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bola1 (GFP-tagged) - Mouse bolA-like 1 (E. coli) (Bola1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human bolA homolog 1 (E. coli) (BOLA1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BOLA1 (Myc-DDK tagged) - Human bolA homolog 1 (E. coli) (BOLA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human bolA homolog 1 (E. coli) (BOLA1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BOLA1 (mGFP-tagged) - Human bolA homolog 1 (E. coli) (BOLA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BOLA1 (GFP-tagged) - Human bolA homolog 1 (E. coli) (BOLA1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Bola1 (Myc-DDK-tagged ORF) - Rat bolA homolog 1 (E. coli) (Bola1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Bola1 (Myc-DDK-tagged ORF) - Rat bolA homolog 1 (E. coli) (Bola1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bola1 (Myc-DDK-tagged ORF) - Rat bolA homolog 1 (E. coli) (Bola1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Bola1 (mGFP-tagged ORF) - Rat bolA homolog 1 (E. coli) (Bola1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Bola1 (GFP-tagged ORF) - Rat bolA homolog 1 (E. coli) (Bola1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BOLA1 (untagged)-Human bolA homolog 1 (E. coli) (BOLA1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Bola1 (untagged) - Mouse bolA-like 1 (E. coli) (Bola1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
BOLA1 (untagged)-Human bolA homolog 1 (E. coli) (BOLA1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CGI Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CGI-143 antibody: synthetic peptide directed towards the N terminal of human CGI-143. Synthetic peptide located within the following region: AGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVV |
Rabbit Polyclonal Anti-Bola1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE |
BOLA1 (21-137, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
BOLA1 (21-137, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
BOLA1 CRISPRa kit - CRISPR gene activation of human bolA family member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene BOLA1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene BOLA1
qPCR primer pairs and template standards against Mus musculus gene Bola1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Bola1
AAV ORF Particles, serotype AAV-2, Bola1 (Myc-DDK-tagged) - Mouse bolA-like 1 (E. coli) (Bola1), 250ul, >10^13 TU/mL
- AAV ORF®
-
BOLA1 MS Standard C13 and N15-labeled recombinant protein (NP_057158)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, BOLA1 (Myc-DDK-tagged)-Human bolA homolog 1 (E. coli) (BOLA1), 250ul, >10^13 TU/mL
- AAV ORF®
-
Bola1 (untagged ORF) - Rat bolA homolog 1 (E. coli) (Bola1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of bolA homolog 1 (E. coli) (BOLA1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
BOLA1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Bola1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Bola1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
BOLA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Transient overexpression of BOLA1 (NM_016074) in HEK293T cells paraffin embedded controls for ICC/IHC staining
BOLA1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
BOLA1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Bola1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Bola1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Bola1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Bola1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse bolA-like 1 (E. coli) (Bola1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Active filters
Target Symbol
- BOLA1