Products

View as table Download

Rabbit Polyclonal Anti-NOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2.

Goat Anti-CYBB / GP91-PHOX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SYLNFARKRIKNP, from the internal region of the protein sequence according to NP_000388.2.

Rabbit anti-CYBB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYBB

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

CYBB (151-163) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CYBB / gp91phox (NP_000388.2)

Rabbit Polyclonal Anti-CYBB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB

CYBB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB

NOX2/gp91phox Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (NP_000388.2).
Modifications Unmodified

NOX2 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human CYBB. AA range:111-160