Germany
Japan
United Kingdom
China
CYBB (Myc-DDK-tagged)-Human cytochrome b-245, beta polypeptide (CYBB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadCybb (Myc-DDK-tagged) - Mouse cytochrome b-245, beta polypeptide (Cybb)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cybb (GFP-tagged) - Mouse cytochrome b-245, beta polypeptide (Cybb)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CYBB (Myc-DDK tagged) - Human cytochrome b-245, beta polypeptide (CYBB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYBB (mGFP-tagged) - Human cytochrome b-245, beta polypeptide (CYBB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYBB (GFP-tagged) - Human cytochrome b-245, beta polypeptide (CYBB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CYBB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407544 is the updated version of KN207544.
Cybb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504075 is the updated version of KN304075.
Cybb (untagged) - Mouse cytochrome b-245, beta polypeptide (Cybb), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cybb (Myc-DDK-tagged) - Mouse cytochrome b-245, beta polypeptide (Cybb)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cybb (Myc-DDK-tagged) - Mouse cytochrome b-245, beta polypeptide (Cybb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cybb (mGFP-tagged) - Mouse cytochrome b-245, beta polypeptide (Cybb)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cybb (GFP-tagged) - Mouse cytochrome b-245, beta polypeptide (Cybb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome b-245, beta polypeptide (CYBB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYBB (Myc-DDK tagged) - Human cytochrome b-245, beta polypeptide (CYBB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome b-245, beta polypeptide (CYBB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYBB (mGFP-tagged) - Human cytochrome b-245, beta polypeptide (CYBB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cybb (Myc-DDK-tagged ORF) - Rat cytochrome b-245, beta polypeptide (Cybb), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cybb (Myc-DDK-tagged ORF) - Rat cytochrome b-245, beta polypeptide (Cybb), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cybb (Myc-DDK-tagged ORF) - Rat cytochrome b-245, beta polypeptide (Cybb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cybb (mGFP-tagged ORF) - Rat cytochrome b-245, beta polypeptide (Cybb), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cybb (GFP-tagged ORF) - Rat cytochrome b-245, beta polypeptide (Cybb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYBB (untagged)-Human cytochrome b-245, beta polypeptide (CYBB)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CYBB - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
CYBB - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
CYBB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene CYBB
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Human cytochrome b-245, beta polypeptide (CYBB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Cybb (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
CYBB - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Cybb - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
CYBB (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319853 is the updated version of SR301088.
Cybb - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Lenti ORF clone of Human cytochrome b-245, beta polypeptide (CYBB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Cybb (untagged ORF) - Rat cytochrome b-245, beta polypeptide (Cybb), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Cybb
Rabbit anti-CYBB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYBB |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Cybb - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human cytochrome b-245, beta polypeptide (CYBB), Glu283-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Cybb - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
CYBB (151-163) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide from an internal region of human CYBB / gp91phox (NP_000388.2) |
CYBB - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |
Cybb - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
CYBB CRISPRa kit - CRISPR gene activation of human cytochrome b-245 beta chain
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cybb CRISPRa kit - CRISPR gene activation of mouse cytochrome b-245, beta polypeptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CYBB
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- CYBB