Products

cDNA Clones (50)
Proteins (21)
RNAi (13)
Primary Antibodies (10)
Gene Expression (6)
Jump to Filters
View as table Download
DAXX Rabbit Monoclonal Antibody [Clone ID: E94]
TA300370

USD 523.00

In Stock

Rabbit Monoclonal Antibody against DAXX (Clone E94)

Applications FC, IHC, WB
Reactivities Human
DAXX Rabbit Polyclonal Antibody
AP20484PU-N

USD 407.00

2 Weeks

DAXX rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DAXX Rabbit Polyclonal Antibody
TA305964

USD 430.00

5 Days

Rabbit Polyclonal Daxx Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Daxx antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Daxx. The immunogen is located within the last 50 amino acids of Daxx.
DAXX Rabbit Polyclonal Antibody
TA319148

USD 530.00

5 Days

Rabbit polyclonal anti-DAXX antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 261-274 of human DAXX protein.
DAXX Rabbit Polyclonal Antibody
TA342864

USD 375.00

5 Days

Rabbit Polyclonal Anti-DAXX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAXX antibody is: synthetic peptide directed towards the C-terminal region of Human DAXX. Synthetic peptide located within the following region: VSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHE
DAXX Rabbit Polyclonal Antibody
TA357674

USD 360.00

5 Days

DAXX Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DAXX
Daxx Rabbit Polyclonal Antibody
TA363695

USD 360.00

5 Days

DAXX Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse DAXX
DAXX Rabbit Polyclonal Antibody
TA375326

USD 220.00

3 Weeks

Daxx Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-740 of human Daxx (NP_001135441.1).
Modifications Unmodified
DAXX Rabbit Polyclonal Antibody
TA384084

USD 380.00

4 Weeks

Daxx Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Daxx
DAXX Rabbit Polyclonal Antibody
TA392902

USD 285.00

4 Weeks

Daxx (phospho-S668) polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Daxx around the phosphorylation site of Serine 668.