Rabbit Polyclonal Anti-SIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
Rabbit Polyclonal Anti-Sip1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sip1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEG |
Carrier-free (BSA/glycerol-free) SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
