Products

cDNA Clones (39)
Proteins (14)
RNAi (12)
Gene Expression (8)
Primary Antibodies (1)
Jump to Filters
View as table Download
LSM5 Rabbit Polyclonal Antibody
TA333880

USD 375.00

5 Days

Rabbit Polyclonal Anti-LSM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV