Products

cDNA Clones (39)
Proteins (14)
RNAi (12)
Gene Expression (8)
Antibodies (1)
Jump to Filters
View as table Download
LSM5 (NM_012322) Human Tagged ORF Clone
RC203266

USD 98.00

USD 390.00

In Stock

LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Lsm5 (NM_025520) Mouse Tagged ORF Clone
MR200229

USD 68.00

USD 390.00

In Stock

Lsm5 (Myc-DDK-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM5 (NM_012322) Human Tagged ORF Clone
RG203266

USD 460.00

In Stock

LSM5 (GFP-tagged) - Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM5 Human Gene Knockout Kit (CRISPR)
KN403266

USD 1,290.00

2 Weeks

LSM5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403266 is the updated version of KN203266.
Lsm5 Mouse Gene Knockout Kit (CRISPR)
KN509535

USD 1,290.00

2 Weeks

Lsm5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509535 is the updated version of KN309535.
Lsm5 (NM_025520) Mouse Tagged ORF Clone
MG200229

USD 300.00

3 Weeks

Lsm5 (GFP-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lsm5 (NM_025520) Mouse Tagged ORF Clone
MR200229L3

USD 500.00

3 Weeks

Lenti ORF clone of Lsm5 (Myc-DDK-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lsm5 (NM_025520) Mouse Tagged ORF Clone Lentiviral Particle
MR200229L3V

USD 700.00

6 Weeks

Lenti ORF particles, Lsm5 (Myc-DDK-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lsm5 (NM_025520) Mouse Tagged ORF Clone
MR200229L4

USD 500.00

3 Weeks

Lenti ORF clone of Lsm5 (mGFP-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lsm5 (NM_025520) Mouse Tagged ORF Clone Lentiviral Particle
MR200229L4V

USD 700.00

6 Weeks

Lenti ORF particles, Lsm5 (GFP-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_012322) Human Tagged ORF Clone
RC203266L3

USD 620.00

3 Weeks

Lenti ORF clone of Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_012322) Human Tagged ORF Clone Lentiviral Particle
RC203266L3V

USD 820.00

6 Weeks

Lenti ORF particles, LSM5 (Myc-DDK tagged) - Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_012322) Human Tagged ORF Clone
RC203266L4

USD 620.00

3 Weeks

Lenti ORF clone of Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_012322) Human Tagged ORF Clone Lentiviral Particle
RC203266L4V

USD 820.00

6 Weeks

Lenti ORF particles, LSM5 (mGFP-tagged) - Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001130710) Human Tagged ORF Clone
RC224985

USD 420.00

2 Weeks

LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM5 (NM_001130710) Human Tagged ORF Clone
RC224985L3

USD 620.00

8 Weeks

Lenti-ORF clone of LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001130710) Human Tagged ORF Clone Lentiviral Particle
RC224985L3V

USD 820.00

11 Weeks

Lenti ORF particles, LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001130710) Human Tagged ORF Clone
RC224985L4

USD 620.00

8 Weeks

Lenti-ORF clone of LSM5 (mGFP-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001130710) Human Tagged ORF Clone Lentiviral Particle
RC224985L4V

USD 820.00

11 Weeks

Lenti ORF particles, LSM5 (mGFP-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001139499) Human Tagged ORF Clone
RC227982

USD 420.00

2 Weeks

LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM5 (NM_001139499) Human Tagged ORF Clone
RC227982L3

USD 620.00

8 Weeks

Lenti-ORF clone of LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001139499) Human Tagged ORF Clone Lentiviral Particle
RC227982L3V

USD 820.00

11 Weeks

Lenti ORF particles, LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001139499) Human Tagged ORF Clone
RC227982L4

USD 620.00

8 Weeks

Lenti-ORF clone of LSM5 (mGFP-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001139499) Human Tagged ORF Clone Lentiviral Particle
RC227982L4V

USD 820.00

11 Weeks

Lenti ORF particles, LSM5 (mGFP-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_001130710) Human Tagged ORF Clone
RG224985

USD 460.00

3 Weeks

LSM5 (GFP-tagged) - Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM5 (NM_001139499) Human Tagged ORF Clone
RG227982

USD 460.00

3 Weeks

LSM5 (GFP-tagged) - Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lsm5 (NM_001107289) Rat Tagged ORF Clone
RR203018

USD 420.00

3 Weeks

Lsm5 (Myc-DDK-tagged ORF) - Rat LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lsm5 (NM_001107289) Rat Tagged ORF Clone
RR203018L3

USD 640.00

7 Weeks

Lenti ORF clone of Lsm5 (Myc-DDK-tagged ORF) - Rat LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lsm5 (NM_001107289) Rat Tagged ORF Clone Lentiviral Particle
RR203018L3V

USD 850.00

11 Weeks

Lenti ORF particles, Lsm5 (Myc-DDK-tagged ORF) - Rat LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lsm5 (NM_001107289) Rat Tagged ORF Clone
RR203018L4

USD 700.00

7 Weeks

Lenti ORF clone of Lsm5 (mGFP-tagged ORF) - Rat LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lsm5 (NM_001107289) Rat Tagged ORF Clone Lentiviral Particle
RR203018L4V

USD 960.00

11 Weeks

Lenti ORF particles, Lsm5 (GFP-tagged ORF) - Rat LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM5 (NM_012322) Human Untagged Clone
SC115452

USD 310.00

In Stock

LSM5 (untagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LSM5 (NM_012322) Human Over-expression Lysate
LY415800

USD 396.00

5 Days

Transient overexpression lysate of LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LSM5 Rabbit Polyclonal Antibody
TA333880

USD 375.00

5 Days

Rabbit Polyclonal Anti-LSM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
LSM5 (1-91, His-tag) Human Protein
AR51199PU-N

USD 1,105.00

2 Weeks

LSM5 (1-91, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
LSM5 (1-91, His-tag) Human Protein
AR51199PU-S

USD 415.00

2 Weeks

LSM5 (1-91, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human LSM5 activation kit by CRISPRa
GA108465

USD 1,290.00

2 Weeks

LSM5 CRISPRa kit - CRISPR gene activation of human LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Lsm5 activation kit by CRISPRa
GA206738

USD 1,290.00

2 Weeks

Lsm5 CRISPRa kit - CRISPR gene activation of mouse LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
LSM5 Human qPCR Template Standard (NM_012322)
HK204452

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene LSM5

Application Plasmid of exact quantity for transcript copy number calculation
LSM5 Human qPCR Template Standard (NM_012322)
HK204453

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene LSM5

Application Plasmid of exact quantity for transcript copy number calculation
LSM5 Human qPCR Primer Pair (NM_012322)
HP210282

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene LSM5

LSM5 (NM_012322) Human Over-expression Lysate
LC415800

USD 121.00

2 Weeks

LSM5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Lsm5 (NM_025520) Mouse Untagged Clone
MC210352

USD 420.00

2 Weeks

Lsm5 (untagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lsm5 Mouse qPCR Primer Pair (NM_025520)
MP207626

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Lsm5

Mouse Lsm5 (NM_025520) AAV Particle
MR200229A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, Lsm5 (Myc-DDK-tagged) - Mouse LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), 250ul, >10^13 TU/mL

  • AAV ORF®
LSM5 (NM_012322) Human Mass Spec Standard
PH303266

USD 2,055.00

3 Weeks

LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454)

Tag C-Myc/DDK
Expression Host HEK293
Human LSM5 (NM_012322) AAV Particle
RC203266A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, LSM5 (Myc-DDK-tagged)-Human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 250ul, >10^13 TU/mL

  • AAV ORF®
Lsm5 (NM_001107289) Rat Untagged Clone
RN203018

USD 420.00

3 Weeks

Lsm5 (untagged ORF) - Rat LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm5), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
LSM5 (NM_001139499) Human 3' UTR Clone
SC217189

USD 670.00

4 Weeks

3`UTR clone of LSM5 homolog U6 small nuclear RNA associated (S. cerevisiae) (LSM5) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase