Products

View as table Download

Rabbit polyclonal anti-TBPL2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TBPL2.

Rabbit polyclonal TBPL2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TBPL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TBPL2.

Rabbit polyclonal Anti-TRF3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRF3 antibody: synthetic peptide directed towards the N terminal of mouse TRF3. Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR

Rabbit Polyclonal Anti-TBPL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBPL2 antibody is: synthetic peptide directed towards the N-terminal region of Human TBPL2. Synthetic peptide located within the following region: SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ