Products

cDNA Clones (22)
RNAi (11)
Gene Expression (6)
Proteins (6)
Primary Antibodies (4)
Jump to Filters
View as table Download
TBP2 (TBPL2) Rabbit Polyclonal Antibody
TA316397

USD 345.00

In Stock

Rabbit polyclonal anti-TBPL2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TBPL2.
TBP2 (TBPL2) Rabbit Polyclonal Antibody
TA324477

USD 450.00

5 Days

Rabbit polyclonal TBPL2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TBPL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TBPL2.
Tbpl2 Rabbit Polyclonal Antibody
TA331442

USD 310.00

5 Days

Rabbit polyclonal Anti-TRF3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRF3 antibody: synthetic peptide directed towards the N terminal of mouse TRF3. Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR
TBP2 (TBPL2) Rabbit Polyclonal Antibody
TA337706

USD 375.00

5 Days

Rabbit Polyclonal Anti-TBPL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBPL2 antibody is: synthetic peptide directed towards the N-terminal region of Human TBPL2. Synthetic peptide located within the following region: SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ