Products

cDNA Clones (53)
Proteins (27)
RNAi (12)
Gene Expression (8)
Antibodies (4)
Jump to Filters
View as table Download
ACBD4 (NM_024722) Human Tagged ORF Clone
RC206781

USD 420.00

In Stock

ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACBD4 (NM_001135706) Human Tagged ORF Clone
RC226556

USD 420.00

In Stock

ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACBD4 (NM_001135705) Human Tagged ORF Clone
RC227776

USD 420.00

In Stock

ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACBD4 (NM_001135707) Human Tagged ORF Clone
RC227902

USD 420.00

In Stock

ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACBD4 (NM_024722) Human Recombinant Protein
TP306781

USD 823.00

4 Weeks

Recombinant protein of human acyl-Coenzyme A binding domain containing 4 (ACBD4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Acbd4 (NM_025988) Mouse Tagged ORF Clone
MR204824

USD 68.00

USD 219.00

In Stock

Acbd4 (Myc-DDK-tagged) - Mouse acyl-Coenzyme A binding domain containing 4 (Acbd4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACBD4 (NM_001135704) Human Tagged ORF Clone
RC227288

USD 420.00

In Stock

ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ACBD4 (NM_024722) Human Tagged ORF Clone
RG206781

USD 460.00

In Stock

ACBD4 (GFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACBD4 Human Gene Knockout Kit (CRISPR)
KN406781

USD 1,290.00

2 Weeks

ACBD4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406781 is the updated version of KN206781.
Acbd4 Mouse Gene Knockout Kit (CRISPR)
KN500703

USD 1,290.00

2 Weeks

Acbd4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500703 is the updated version of KN300703.
Acbd4 (BC048371) Mouse Tagged ORF Clone
MG204824

USD 300.00

3 Weeks

Acbd4 (GFP-tagged) - Mouse acyl-Coenzyme A binding domain containing 4 (cDNA clone MGC:56753 IMAGE:6396076)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acbd4 (NM_025988) Mouse Tagged ORF Clone
MR204824L3

USD 500.00

3 Weeks

Lenti ORF clone of Acbd4 (Myc-DDK-tagged) - Mouse acyl-Coenzyme A binding domain containing 4 (Acbd4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_025988) Mouse Tagged ORF Clone Lentiviral Particle
MR204824L3V

USD 700.00

6 Weeks

Lenti ORF particles, Acbd4 (Myc-DDK-tagged) - Mouse acyl-Coenzyme A binding domain containing 4 (Acbd4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_025988) Mouse Tagged ORF Clone
MR204824L4

USD 500.00

3 Weeks

Lenti ORF clone of Acbd4 (mGFP-tagged) - Mouse acyl-Coenzyme A binding domain containing 4 (Acbd4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_025988) Mouse Tagged ORF Clone Lentiviral Particle
MR204824L4V

USD 700.00

6 Weeks

Lenti ORF particles, Acbd4 (GFP-tagged) - Mouse acyl-Coenzyme A binding domain containing 4 (Acbd4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_024722) Human Tagged ORF Clone
RC206781L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_024722) Human Tagged ORF Clone Lentiviral Particle
RC206781L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (Myc-DDK tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_024722) Human Tagged ORF Clone
RC206781L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_024722) Human Tagged ORF Clone Lentiviral Particle
RC206781L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (mGFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135706) Human Tagged ORF Clone
RC226556L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135706) Human Tagged ORF Clone Lentiviral Particle
RC226556L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (Myc-DDK tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135706) Human Tagged ORF Clone
RC226556L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135706) Human Tagged ORF Clone Lentiviral Particle
RC226556L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (mGFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135704) Human Tagged ORF Clone
RC227288L3

USD 620.00

3 Weeks

Lenti-ORF clone of ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135704) Human Tagged ORF Clone Lentiviral Particle
RC227288L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (Myc-DDK-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135704) Human Tagged ORF Clone
RC227288L4

USD 620.00

3 Weeks

Lenti-ORF clone of ACBD4 (mGFP-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135704) Human Tagged ORF Clone Lentiviral Particle
RC227288L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (mGFP-tagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135705) Human Tagged ORF Clone
RC227776L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135705) Human Tagged ORF Clone Lentiviral Particle
RC227776L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (Myc-DDK tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135705) Human Tagged ORF Clone
RC227776L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135705) Human Tagged ORF Clone Lentiviral Particle
RC227776L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (mGFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135707) Human Tagged ORF Clone
RC227902L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135707) Human Tagged ORF Clone Lentiviral Particle
RC227902L3V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (Myc-DDK tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135707) Human Tagged ORF Clone
RC227902L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135707) Human Tagged ORF Clone Lentiviral Particle
RC227902L4V

USD 820.00

6 Weeks

Lenti ORF particles, ACBD4 (mGFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACBD4 (NM_001135706) Human Tagged ORF Clone
RG226556

USD 460.00

3 Weeks

ACBD4 (GFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACBD4 (NM_001135704) Human Tagged ORF Clone
RG227288

USD 460.00

3 Weeks

ACBD4 (GFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACBD4 (NM_001135705) Human Tagged ORF Clone
RG227776

USD 460.00

3 Weeks

ACBD4 (GFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACBD4 (NM_001135707) Human Tagged ORF Clone
RG227902

USD 460.00

3 Weeks

ACBD4 (GFP-tagged) - Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acbd4 (NM_001012013) Rat Tagged ORF Clone
RR209110

USD 420.00

4 Weeks

Acbd4 (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A binding domain containing 4 (Acbd4), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acbd4 (NM_001012013) Rat Tagged ORF Clone
RR209110L3

USD 640.00

8 Weeks

Lenti ORF clone of Acbd4 (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A binding domain containing 4 (Acbd4), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_001012013) Rat Tagged ORF Clone Lentiviral Particle
RR209110L3V

USD 850.00

12 Weeks

Lenti ORF particles, Acbd4 (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A binding domain containing 4 (Acbd4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_001012013) Rat Tagged ORF Clone
RR209110L4

USD 700.00

8 Weeks

Lenti ORF clone of Acbd4 (mGFP-tagged ORF) - Rat acyl-Coenzyme A binding domain containing 4 (Acbd4), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_001012013) Rat Tagged ORF Clone Lentiviral Particle
RR209110L4V

USD 960.00

12 Weeks

Lenti ORF particles, Acbd4 (GFP-tagged ORF) - Rat acyl-Coenzyme A binding domain containing 4 (Acbd4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acbd4 (NM_025988) Mouse Untagged Clone
MC203504

USD 210.00

In Stock

Acbd4 (untagged) - Mouse acyl-Coenzyme A binding domain containing 4 (Acbd4), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
ACBD4 (NM_024722) Human Untagged Clone
SC321788

USD 660.00

In Stock

ACBD4 (untagged)-Human acyl-CoA binding domain containing 4 (ACBD4), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ACBD4 Rabbit Polyclonal Antibody
TA338669

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACBD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACBD4 antibody: synthetic peptide directed towards the N terminal of human ACBD4. Synthetic peptide located within the following region: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT
ACBD4 Rabbit Polyclonal Antibody
TA338670

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACBD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACBD4 antibody: synthetic peptide directed towards the N terminal of human ACBD4. Synthetic peptide located within the following region: NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
Human ACBD4 activation kit by CRISPRa
GA112617

USD 1,290.00

2 Weeks

ACBD4 CRISPRa kit - CRISPR gene activation of human acyl-CoA binding domain containing 4

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Acbd4 activation kit by CRISPRa
GA207158

USD 1,290.00

2 Weeks

Acbd4 CRISPRa kit - CRISPR gene activation of mouse acyl-Coenzyme A binding domain containing 4

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector