Products

cDNA Clones (30)
Proteins (13)
RNAi (12)
Gene Expression (5)
Antibodies (2)
Jump to Filters
View as table Download
ATP6V1G3 (NM_133262) Human Tagged ORF Clone
RC221453

USD 420.00

In Stock

ATP6V1G3 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ATP6V1G3 (NM_133326) Human Tagged ORF Clone
RC222686

USD 420.00

In Stock

ATP6V1G3 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Atp6v1g3 (NM_177397) Mouse Tagged ORF Clone
MR223489

USD 68.00

USD 390.00

In Stock

Atp6v1g3 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V1G3 (NM_133262) Human Tagged ORF Clone
RG221453

USD 460.00

In Stock

ATP6V1G3 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V1G3 (NM_133326) Human Tagged ORF Clone
RG222686

USD 460.00

In Stock

ATP6V1G3 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V1G3 Human Gene Knockout Kit (CRISPR)
KN421453

USD 1,290.00

2 Weeks

ATP6V1G3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN421453 is the updated version of KN221453.
Atp6v1g3 Mouse Gene Knockout Kit (CRISPR)
KN501827

USD 1,290.00

2 Weeks

Atp6v1g3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501827 is the updated version of KN301827.
Atp6v1g3 (NM_177397) Mouse Tagged ORF Clone
MG223489

USD 300.00

3 Weeks

Atp6v1g3 (GFP-tagged) - Mouse ATPase H+ transporting lysosomal V1 subunit G3 (Atp6v1g3), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp6v1g3 (NM_177397) Mouse Tagged ORF Clone
MR223489L3

USD 500.00

3 Weeks

Lenti ORF clone of Atp6v1g3 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_177397) Mouse Tagged ORF Clone Lentiviral Particle
MR223489L3V

USD 700.00

6 Weeks

Lenti ORF particles, Atp6v1g3 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_177397) Mouse Tagged ORF Clone
MR223489L4

USD 500.00

3 Weeks

Lenti ORF clone of Atp6v1g3 (mGFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_177397) Mouse Tagged ORF Clone Lentiviral Particle
MR223489L4V

USD 700.00

6 Weeks

Lenti ORF particles, Atp6v1g3 (GFP-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133262) Human Tagged ORF Clone
RC221453L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133262) Human Tagged ORF Clone Lentiviral Particle
RC221453L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V1G3 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133262) Human Tagged ORF Clone
RC221453L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133262) Human Tagged ORF Clone Lentiviral Particle
RC221453L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V1G3 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133326) Human Tagged ORF Clone
RC222686L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133326) Human Tagged ORF Clone Lentiviral Particle
RC222686L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V1G3 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133326) Human Tagged ORF Clone
RC222686L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133326) Human Tagged ORF Clone Lentiviral Particle
RC222686L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V1G3 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_001105991) Rat Tagged ORF Clone
RR205325

USD 420.00

4 Weeks

Atp6v1g3 (Myc-DDK-tagged ORF) - Rat ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Atp6v1g3 (NM_001105991) Rat Tagged ORF Clone
RR205325L3

USD 640.00

8 Weeks

Lenti ORF clone of Atp6v1g3 (Myc-DDK-tagged ORF) - Rat ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_001105991) Rat Tagged ORF Clone Lentiviral Particle
RR205325L3V

USD 850.00

12 Weeks

Lenti ORF particles, Atp6v1g3 (Myc-DDK-tagged ORF) - Rat ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_001105991) Rat Tagged ORF Clone
RR205325L4

USD 700.00

8 Weeks

Lenti ORF clone of Atp6v1g3 (mGFP-tagged ORF) - Rat ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Atp6v1g3 (NM_001105991) Rat Tagged ORF Clone Lentiviral Particle
RR205325L4V

USD 960.00

12 Weeks

Lenti ORF particles, Atp6v1g3 (GFP-tagged ORF) - Rat ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1G3 (NM_133262) Human Over-expression Lysate
LY408852

USD 396.00

5 Days

Transient overexpression lysate of ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V1G3 Rabbit Polyclonal Antibody
TA343229

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V1G3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Atp6v1g3 antibody is: synthetic peptide directed towards the middle region of Mouse Atp6v1g3. Synthetic peptide located within the following region: MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQ
Human ATP6V1G3 activation kit by CRISPRa
GA114984

USD 1,290.00

2 Weeks

ATP6V1G3 CRISPRa kit - CRISPR gene activation of human ATPase H+ transporting V1 subunit G3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ATP6V1G3 Human qPCR Primer Pair (NM_133262)
HP216838

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ATP6V1G3

ATP6V1G3 (NM_133262) Human Over-expression Lysate
LC408852

USD 121.00

2 Weeks

ATP6V1G3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V1G3 (NM_133326) Human Over-expression Lysate
LC408866

USD 121.00

2 Weeks

ATP6V1G3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V1G3 (NM_133326) Human Over-expression Lysate
LY408866

USD 396.00

5 Days

Transient overexpression lysate of ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Atp6v1g3 (NM_177397) Mouse Untagged Clone
MC214635

USD 420.00

2 Weeks

Atp6v1g3 (untagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Atp6v1g3 Mouse qPCR Primer Pair (NM_177397)
MP201104

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Atp6v1g3

Mouse Atp6v1g3 (NM_177397) AAV Particle
MR223489A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, Atp6v1g3 (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), 250ul, >10^13 TU/mL

  • AAV ORF®
ATP6V1G3 (NM_133262) Human Mass Spec Standard
PH321453

USD 2,055.00

3 Weeks

ATP6V1G3 MS Standard C13 and N15-labeled recombinant protein (NP_573569)

Tag C-Myc/DDK
Expression Host HEK293
ATP6V1G3 (NM_133326) Human Mass Spec Standard
PH322686

USD 2,055.00

3 Weeks

ATP6V1G3 MS Standard C13 and N15-labeled recombinant protein (NP_579872)

Tag C-Myc/DDK
Expression Host HEK293
Human ATP6V1G3 (NM_133262) AAV Particle
RC221453A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, ATP6V1G3 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1, 250ul, >10^13 TU/mL

  • AAV ORF®
Human ATP6V1G3 (NM_133326) AAV Particle
RC222686A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, ATP6V1G3 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2, 250ul, >10^13 TU/mL

  • AAV ORF®
Atp6v1g3 (NM_001105991) Rat Untagged Clone
RN205325

USD 420.00

4 Weeks

Atp6v1g3 (untagged ORF) - Rat ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V1G3 (NM_133262) Human Untagged Clone
SC305936

USD 420.00

3 Weeks

ATP6V1G3 (untagged)-Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V1G3 (NM_133326) Human Untagged Clone
SC305942

USD 420.00

3 Weeks

ATP6V1G3 (untagged)-Human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V1G3 Human siRNA Oligo Duplex (Locus ID 127124)
SR314968

USD 430.00

2 Weeks

ATP6V1G3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Atp6v1g3 Mouse siRNA Oligo Duplex (Locus ID 338375)
SR401756

USD 430.00

2 Weeks

Atp6v1g3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Atp6v1g3 Rat siRNA Oligo Duplex (Locus ID 289407)
SR505039

USD 430.00

2 Weeks

Atp6v1g3 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

ATP6V1G3 Rabbit Polyclonal Antibody
TA373847

USD 220.00

3 Weeks

ATP6V1G3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1).
Modifications Unmodified
ATP6V1G3 (NM_133262) ICC Control Block
TB421453

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V1G3 (NM_133262) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V1G3 (NM_133326) ICC Control Block
TB422686

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V1G3 (NM_133326) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V1G3 Human shRNA Plasmid Kit (Locus ID 127124)
TL306496

USD 815.00

2 Weeks

ATP6V1G3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
ATP6V1G3 Human shRNA Lentiviral Particle (Locus ID 127124)
TL306496V

USD 1,395.00

5 Weeks

ATP6V1G3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti