Products

Proteins (27)
cDNA Clones (27)
Gene Expression (4)
RNAi (3)
Antibodies (2)
Jump to Filters
View as table Download
Carbonic anhydrase X (CA10) (NM_020178) Human Tagged ORF Clone
RG213425

USD 460.00

In Stock

CA10 (GFP-tagged) - Human carbonic anhydrase X (CA10), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic anhydrase X (CA10) Human Gene Knockout Kit (CRISPR)
KN409723

USD 1,290.00

2 Weeks

CA10 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409723 is the updated version of KN209723.
Carbonic anhydrase X (CA10) (NM_001082533) Human Tagged ORF Clone Lentiviral Particle
RC209723L3V

USD 820.00

5 Weeks

Lenti ORF particles, CA10 (Myc-DDK tagged) - Human carbonic anhydrase X (CA10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic anhydrase X (CA10) (NM_001082533) Human Tagged ORF Clone Lentiviral Particle
RC209723L4V

USD 820.00

7 Weeks

Lenti ORF particles, CA10 (mGFP-tagged) - Human carbonic anhydrase X (CA10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic anhydrase X (CA10) (NM_001082534) Human Tagged ORF Clone Lentiviral Particle
RC212539L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA10 (Myc-DDK tagged) - Human carbonic anhydrase X (CA10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic anhydrase X (CA10) (NM_001082534) Human Tagged ORF Clone Lentiviral Particle
RC212539L4V

USD 820.00

6 Weeks

Lenti ORF particles, CA10 (mGFP-tagged) - Human carbonic anhydrase X (CA10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic anhydrase X (CA10) (NM_020178) Human Tagged ORF Clone Lentiviral Particle
RC213425L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA10 (Myc-DDK tagged) - Human carbonic anhydrase X (CA10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic anhydrase X (CA10) (NM_020178) Human Tagged ORF Clone Lentiviral Particle
RC213425L4V

USD 820.00

6 Weeks

Lenti ORF particles, CA10 (mGFP-tagged) - Human carbonic anhydrase X (CA10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic anhydrase X (CA10) (NM_001082533) Human Tagged ORF Clone
RG209723

USD 460.00

3 Weeks

CA10 (GFP-tagged) - Human carbonic anhydrase X (CA10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic anhydrase X (CA10) (NM_001082534) Human Tagged ORF Clone
RG212539

USD 460.00

3 Weeks

CA10 (GFP-tagged) - Human carbonic anhydrase X (CA10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic anhydrase X (CA10) (NM_020178) Human Untagged Clone
SC111362

USD 310.00

In Stock

CA10 (untagged)-Human carbonic anhydrase X (CA10), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Carbonic anhydrase X (CA10) (NM_020178) Human Over-expression Lysate
LY412601

USD 396.00

5 Days

Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) Rabbit Polyclonal Antibody
TA335501

USD 375.00

5 Days

Rabbit Polyclonal Anti-CA10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CA10 Antibody is: synthetic peptide directed towards the N-terminal region of Human CA10. Synthetic peptide located within the following region: NISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHEL
Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein
TP720625

USD 330.00

3 Weeks

Purified recombinant protein of Human carbonic anhydrase X (CA10), transcript variant 1

Tag C-His
Expression Host HEK293
Human Carbonic anhydrase X (CA10) activation kit by CRISPRa
GA111281

USD 1,290.00

2 Weeks

CA10 CRISPRa kit - CRISPR gene activation of human carbonic anhydrase 10

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CA10 Human qPCR Template Standard (NM_020178)
HK201579

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CA10

Application Plasmid of exact quantity for transcript copy number calculation
Carbonic anhydrase X (CA10) (NM_020178) Human Over-expression Lysate
LC412601

USD 121.00

2 Weeks

CA10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082533) Human Over-expression Lysate
LC421186

USD 121.00

2 Weeks

CA10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082534) Human Over-expression Lysate
LC421187

USD 121.00

2 Weeks

CA10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082533) Human Over-expression Lysate
LC425939

USD 121.00

2 Weeks

CA10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082534) Human Over-expression Lysate
LC425940

USD 121.00

2 Weeks

CA10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082533) Human Over-expression Lysate
LY421186

USD 396.00

5 Days

Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421186 is the same product as LY425939.
Carbonic anhydrase X (CA10) (NM_001082534) Human Over-expression Lysate
LY421187

USD 396.00

5 Days

Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY421187 is the same product as LY425940.
Carbonic anhydrase X (CA10) (NM_001082533) Human Over-expression Lysate
LY425939

USD 396.00

5 Days

Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082534) Human Over-expression Lysate
LY425940

USD 396.00

5 Days

Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carbonic anhydrase X (CA10) (NM_001082533) Human Mass Spec Standard
PH309723

USD 2,055.00

3 Weeks

CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076002)

Tag C-Myc/DDK
Expression Host HEK293
Carbonic anhydrase X (CA10) (NM_001082534) Human Mass Spec Standard
PH312539

USD 2,055.00

3 Weeks

CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076003)

Tag C-Myc/DDK
Expression Host HEK293
Carbonic anhydrase X (CA10) (NM_020178) Human Mass Spec Standard
PH313425

USD 2,055.00

3 Weeks

CA10 MS Standard C13 and N15-labeled recombinant protein (NP_064563)

Tag C-Myc/DDK
Expression Host HEK293
Carbonic anhydrase X (CA10) (NM_001082534) Human 3' UTR Clone
SC213720

USD 560.00

4 Weeks

3`UTR clone of carbonic anhydrase X (CA10) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Carbonic anhydrase X (CA10) (NM_001082533) Human 3' UTR Clone
SC213721

USD 560.00

4 Weeks

3`UTR clone of carbonic anhydrase X (CA10) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Carbonic anhydrase X (CA10) (NM_020178) Human 3' UTR Clone
SC213722

USD 560.00

4 Weeks

3`UTR clone of carbonic anhydrase X (CA10) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Carbonic anhydrase X (CA10) (NM_001082534) Human Untagged Clone
SC315993

USD 660.00

3 Weeks

CA10 (untagged)-Human carbonic anhydrase X (CA10), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Carbonic anhydrase X (CA10) (NM_001082533) Human Untagged Clone
SC315994

USD 660.00

3 Weeks

CA10 (untagged)-Human carbonic anhydrase X (CA10), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Carbonic anhydrase X (CA10) Rabbit Polyclonal Antibody
TA323299

USD 345.00

In Stock

Anti-CA10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic anhydrase X (CA10) (NM_001082533) ICC Control Block
TB409723

USD 1,070.00

4 Weeks

Transient overexpression of CA10 (NM_001082533) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carbonic anhydrase X (CA10) (NM_001082534) ICC Control Block
TB412539

USD 1,070.00

4 Weeks

Transient overexpression of CA10 (NM_001082534) in HEK293T cells paraffin embedded controls for ICC/IHC staining