Products

cDNA Clones (35)
Proteins (22)
RNAi (12)
Gene Expression (8)
Antibodies (4)
Jump to Filters
View as table Download
CAB39 (NM_016289) Human Tagged ORF Clone
RC204563

USD 420.00

In Stock

CAB39 (Myc-DDK-tagged)-Human calcium binding protein 39 (CAB39), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CAB39 (NM_001130849) Human Tagged ORF Clone
RC225504

USD 420.00

In Stock

CAB39 (Myc-DDK-tagged)-Human calcium binding protein 39 (CAB39), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CAB39 (NM_001130850) Human Tagged ORF Clone
RC225505

USD 420.00

In Stock

CAB39 (Myc-DDK-tagged)-Human calcium binding protein 39 (CAB39), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cab39 (NM_133781) Mouse Tagged ORF Clone
MR205117

USD 350.00

In Stock

Cab39 (Myc-DDK-tagged) - Mouse calcium binding protein 39 (Cab39)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CAB39 (NM_016289) Human Tagged ORF Clone
RG204563

USD 460.00

In Stock

CAB39 (GFP-tagged) - Human calcium binding protein 39 (CAB39), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CAB39 Human Gene Knockout Kit (CRISPR)
KN404563

USD 1,290.00

2 Weeks

CAB39 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404563 is the updated version of KN204563.
Cab39 Mouse Gene Knockout Kit (CRISPR)
KN502399

USD 1,290.00

2 Weeks

Cab39 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502399 is the updated version of KN302399.
Cab39 (NM_133781) Mouse Tagged ORF Clone
MG205117

USD 390.00

3 Weeks

Cab39 (GFP-tagged) - Mouse calcium binding protein 39 (Cab39)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cab39 (NM_133781) Mouse Tagged ORF Clone
MR205117L3

USD 550.00

3 Weeks

Lenti ORF clone of Cab39 (Myc-DDK-tagged) - Mouse calcium binding protein 39 (Cab39)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cab39 (NM_133781) Mouse Tagged ORF Clone
MR205117L4

USD 550.00

3 Weeks

Lenti ORF clone of Cab39 (mGFP-tagged) - Mouse calcium binding protein 39 (Cab39)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cab39 (NM_133781) Mouse Tagged ORF Clone Lentiviral Particle
MR205117L4V

USD 750.00

6 Weeks

Lenti ORF particles, Cab39 (GFP-tagged) - Mouse calcium binding protein 39 (Cab39), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_016289) Human Tagged ORF Clone
RC204563L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium binding protein 39 (CAB39), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_016289) Human Tagged ORF Clone Lentiviral Particle
RC204563L3V

USD 820.00

6 Weeks

Lenti ORF particles, CAB39 (Myc-DDK tagged) - Human calcium binding protein 39 (CAB39), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_016289) Human Tagged ORF Clone
RC204563L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium binding protein 39 (CAB39), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_016289) Human Tagged ORF Clone Lentiviral Particle
RC204563L4V

USD 820.00

6 Weeks

Lenti ORF particles, CAB39 (mGFP-tagged) - Human calcium binding protein 39 (CAB39), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130849) Human Tagged ORF Clone
RC225504L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium binding protein 39 (CAB39), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130849) Human Tagged ORF Clone Lentiviral Particle
RC225504L3V

USD 820.00

6 Weeks

Lenti ORF particles, CAB39 (Myc-DDK tagged) - Human calcium binding protein 39 (CAB39), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130849) Human Tagged ORF Clone
RC225504L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium binding protein 39 (CAB39), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130849) Human Tagged ORF Clone Lentiviral Particle
RC225504L4V

USD 820.00

6 Weeks

Lenti ORF particles, CAB39 (mGFP-tagged) - Human calcium binding protein 39 (CAB39), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130850) Human Tagged ORF Clone
RC225505L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium binding protein 39 (CAB39), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130850) Human Tagged ORF Clone Lentiviral Particle
RC225505L3V

USD 820.00

6 Weeks

Lenti ORF particles, CAB39 (Myc-DDK tagged) - Human calcium binding protein 39 (CAB39), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130850) Human Tagged ORF Clone
RC225505L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium binding protein 39 (CAB39), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130850) Human Tagged ORF Clone Lentiviral Particle
RC225505L4V

USD 820.00

6 Weeks

Lenti ORF particles, CAB39 (mGFP-tagged) - Human calcium binding protein 39 (CAB39), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 (NM_001130849) Human Tagged ORF Clone
RG225504

USD 460.00

3 Weeks

CAB39 (GFP-tagged) - Human calcium binding protein 39 (CAB39), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CAB39 (NM_001130850) Human Tagged ORF Clone
RG225505

USD 460.00

3 Weeks

CAB39 (GFP-tagged) - Human calcium binding protein 39 (CAB39), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cab39 (NM_001106924) Rat Tagged ORF Clone
RR206708

USD 420.00

4 Weeks

Cab39 (Myc-DDK-tagged ORF) - Rat calcium binding protein 39 (Cab39), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cab39 (NM_001106924) Rat Tagged ORF Clone
RR206708L3

USD 640.00

8 Weeks

Lenti ORF clone of Cab39 (Myc-DDK-tagged ORF) - Rat calcium binding protein 39 (Cab39), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cab39 (NM_001106924) Rat Tagged ORF Clone
RR206708L4

USD 700.00

8 Weeks

Lenti ORF clone of Cab39 (mGFP-tagged ORF) - Rat calcium binding protein 39 (Cab39), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cab39 (NM_001106924) Rat Tagged ORF Clone Lentiviral Particle
RR206708L4V

USD 960.00

12 Weeks

Lenti ORF particles, Cab39 (GFP-tagged ORF) - Rat calcium binding protein 39 (Cab39), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CAB39 Rabbit Polyclonal Antibody
TA371430

USD 380.00

4 Weeks

CAB39 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAB39
CAB39 (NM_001130849) Human Over-expression Lysate
LY427286

USD 396.00

In Stock

Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAB39 (NM_016289) Human Untagged Clone
SC127652

USD 310.00

In Stock

CAB39 (untagged)-Human calcium binding protein 39 (CAB39), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CAB39 (NM_016289) Human Untagged Clone
SC322466

USD 310.00

In Stock

CAB39 (untagged)-Human calcium binding protein 39 (CAB39), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CAB39 Rabbit Polyclonal Antibody
TA345040

USD 475.00

5 Days

Rabbit Polyclonal Anti-CAB39 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAB39 antibody: synthetic peptide directed towards the middle region of human CAB39. Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP
Cab39 (NM_133781) Mouse Untagged Clone
MC203124

USD 210.00

In Stock

Cab39 (untagged) - Mouse calcium binding protein 39 (Cab39), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
CAB39 (NM_001130849) Human Untagged Clone
SC324966

USD 760.00

In Stock

CAB39 (untagged)-Human calcium binding protein 39 (CAB39), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CAB39 (NM_016289) Human Over-expression Lysate
LC402536

USD 121.00

In Stock

CAB39 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAB39 (1-341, His-tag) Human Protein
AR09554PU-L

USD 1,105.00

2 Weeks

CAB39 (1-341, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
CAB39 (1-341, His-tag) Human Protein
AR09554PU-N

USD 415.00

2 Weeks

CAB39 (1-341, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human CAB39 activation kit by CRISPRa
GA109958

USD 1,290.00

2 Weeks

CAB39 CRISPRa kit - CRISPR gene activation of human calcium binding protein 39

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Cab39 activation kit by CRISPRa
GA200474

USD 1,290.00

2 Weeks

Cab39 CRISPRa kit - CRISPR gene activation of mouse calcium binding protein 39

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CAB39 Human qPCR Template Standard (NM_016289)
HK201584

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CAB39

Application Plasmid of exact quantity for transcript copy number calculation
CAB39 Human qPCR Primer Pair (NM_016289)
HP212102

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CAB39

CAB39 (NM_001130849) Human Over-expression Lysate
LC427286

USD 121.00

2 Weeks

CAB39 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAB39 (NM_001130850) Human Over-expression Lysate
LC427287

USD 121.00

2 Weeks

CAB39 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAB39 (NM_016289) Human Over-expression Lysate
LY402536

USD 396.00

5 Days

Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAB39 (NM_001130850) Human Over-expression Lysate
LY427287

USD 396.00

5 Days

Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB