Products

cDNA Clones (54)
Proteins (25)
Antibodies (17)
RNAi (8)
Gene Expression (3)
Jump to Filters
View as table Download
CD8B (NM_172213) Human Tagged ORF Clone
RC215562

USD 98.00

USD 390.00

In Stock

CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD8B (NM_001178100) Human Tagged ORF Clone
RC229674

USD 420.00

In Stock

CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD8B (NM_172213) Human Tagged ORF Clone Lentiviral Particle
RC215562L1V

USD 820.00

3 Weeks

Lenti ORF particles, CD8B (Myc-DDK tagged) - Human CD8b molecule (CD8B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CD8B (NM_172213) Human Tagged ORF Clone Lentiviral Particle
RC215562L2V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (mGFP-tagged) - Human CD8b molecule (CD8B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CD8B (NM_001178100) Human Tagged ORF Clone Lentiviral Particle
RC229674L2V

USD 820.00

3 Weeks

Lenti ORF particles, CD8B (mGFP-tagged) - Human CD8b molecule (CD8B), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CD8B (NM_172101) Human Tagged ORF Clone
RC215505

USD 420.00

In Stock

CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B (NM_004931) Human Tagged ORF Clone
RC215619

USD 420.00

In Stock

CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B (NM_172102) Human Tagged ORF Clone
RC220206

USD 420.00

In Stock

CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B (NM_172213) Human Tagged ORF Clone
RG215562

USD 460.00

In Stock

CD8B (GFP-tagged) - Human CD8b molecule (CD8B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B Human Gene Knockout Kit (CRISPR)
KN415505

USD 1,290.00

2 Weeks

CD8B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN415505 is the updated version of KN215505.
CD8B (NM_172101) Human Tagged ORF Clone
RC215505L3

USD 620.00

3 Weeks

Lenti-ORF clone of CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172101) Human Tagged ORF Clone Lentiviral Particle
RC215505L3V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172101) Human Tagged ORF Clone
RC215505L4

USD 620.00

3 Weeks

Lenti-ORF clone of CD8B (mGFP-tagged)-Human CD8b molecule (CD8B), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172101) Human Tagged ORF Clone Lentiviral Particle
RC215505L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (mGFP-tagged)-Human CD8b molecule (CD8B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172213) Human Tagged ORF Clone
RC215562L3

USD 620.00

In Stock

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172213) Human Tagged ORF Clone Lentiviral Particle
RC215562L3V

USD 820.00

2 Weeks

Lenti ORF particles, CD8B (Myc-DDK tagged) - Human CD8b molecule (CD8B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172213) Human Tagged ORF Clone
RC215562L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172213) Human Tagged ORF Clone Lentiviral Particle
RC215562L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (mGFP-tagged) - Human CD8b molecule (CD8B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_004931) Human Tagged ORF Clone
RC215619L3

USD 620.00

3 Weeks

Lenti-ORF clone of CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_004931) Human Tagged ORF Clone
RC215619L4

USD 620.00

3 Weeks

Lenti-ORF clone of CD8B (mGFP-tagged)-Human CD8b molecule (CD8B), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_004931) Human Tagged ORF Clone Lentiviral Particle
RC215619L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (mGFP-tagged)-Human CD8b molecule (CD8B), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172102) Human Tagged ORF Clone
RC220206L3

USD 620.00

3 Weeks

Lenti-ORF clone of CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172102) Human Tagged ORF Clone Lentiviral Particle
RC220206L3V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172102) Human Tagged ORF Clone
RC220206L4

USD 620.00

3 Weeks

Lenti-ORF clone of CD8B (mGFP-tagged)-Human CD8b molecule (CD8B), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172102) Human Tagged ORF Clone Lentiviral Particle
RC220206L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (mGFP-tagged)-Human CD8b molecule (CD8B), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_001178100) Human Tagged ORF Clone
RC229674L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_001178100) Human Tagged ORF Clone
RC229674L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_001178100) Human Tagged ORF Clone Lentiviral Particle
RC229674L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD8B (mGFP-tagged) - Human CD8b molecule (CD8B), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_172101) Human Tagged ORF Clone
RG215505

USD 460.00

3 Weeks

CD8B (GFP-tagged) - Human CD8b molecule (CD8B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B (NM_004931) Human Tagged ORF Clone
RG215619

USD 460.00

3 Weeks

CD8B (GFP-tagged) - Human CD8b molecule (CD8B), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B (NM_172102) Human Tagged ORF Clone
RG220206

USD 460.00

3 Weeks

CD8B (GFP-tagged) - Human CD8b molecule (CD8B), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD8B (NM_001178100) Human Tagged ORF Clone
RG229674

USD 460.00

3 Weeks

CD8B (GFP-tagged) - Human CD8b molecule (CD8B), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cd8b (NM_031539) Rat Tagged ORF Clone
RR214135

USD 473.00

4 Weeks

Cd8b (Myc-DDK-tagged ORF) - Rat CD8b molecule (Cd8b), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cd8b (NM_031539) Rat Tagged Lenti ORF Clone
RR214135L3

USD 792.00

8 Weeks

Lenti ORF clone of Cd8b (Myc-DDK-tagged ORF) - Rat CD8b molecule (Cd8b), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd8b (NM_031539) Rat Tagged Lenti ORF Clone
RR214135L4

USD 864.00

8 Weeks

Lenti ORF clone of Cd8b (mGFP-tagged ORF) - Rat CD8b molecule (Cd8b), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd8b (NM_031539) Rat Tagged ORF Clone Lentiviral Particle
RR214135L4V

USD 1,188.00

11 Weeks

Lenti ORF particles, Cd8b (GFP-tagged ORF) - Rat CD8b molecule (Cd8b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_001178100) Human Tagged Lenti ORF Clone
RC229674L2

USD 768.00

In Stock

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD8B (NM_004931) Human Tagged ORF Clone Lentiviral Particle
RC215619L3V

USD 1,020.00

6 Weeks

Lenti ORF particles, CD8B (Myc-DDK-tagged)-Human CD8b molecule (CD8B), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD8B (NM_004931) Human Untagged Clone
SC303550

USD 420.00

In Stock

CD8B (untagged)-Human CD8b molecule (CD8B), transcript variant 5

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CD8B Rabbit Polyclonal Antibody
TA346386

USD 475.00

5 Days

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
CD8B Rabbit Polyclonal Antibody
TA346387

USD 475.00

5 Days

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR
CD8B Rabbit Polyclonal Antibody
TA347884

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B
CD8B Mouse Monoclonal Antibody [Clone ID: EP42]
AM08123PU-N

USD 370.00

3 Days

CD8B mouse monoclonal antibody, clone EP42, Purified

Applications FC, IHC, IP
Reactivities Chicken
CD8B (NM_172213) Human Tagged ORF Clone
RC215562L1

USD 620.00

3 Weeks

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CD8B (NM_172213) Human Tagged ORF Clone
RC215562L2

USD 620.00

3 Weeks

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD8B (NM_001178100) Human Tagged ORF Clone
RC229674L1

USD 620.00

3 Weeks

Lenti ORF clone of Human CD8b molecule (CD8B), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CD8B (NM_172101) Human Untagged Clone
SC306716

USD 540.00

In Stock

CD8B (untagged)-Human CD8b molecule (CD8B), transcript variant 3

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin