Products

cDNA Clones (50)
Antibodies (27)
Proteins (25)
RNAi (7)
Gene Expression (5)
Jump to Filters
View as table Download
AMCase (CHIA) (NM_201653) Human Tagged ORF Clone
RC221549

USD 450.00

In Stock

CHIA (Myc-DDK-tagged)-Human chitinase, acidic (CHIA), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AMCase (CHIA) (NM_021797) Human Tagged ORF Clone
RC206441

USD 420.00

In Stock

CHIA (Myc-DDK-tagged)-Human chitinase, acidic (CHIA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Chia (BC011134) Mouse Tagged ORF Clone
MR205616

USD 220.00

In Stock

Chia (Myc-DDK-tagged) - Mouse chitinase, acidic (cDNA clone MGC:18771 IMAGE:4165150)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258001) Human Tagged ORF Clone
RC233892

USD 420.00

In Stock

CHIA (Myc-DDK tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258003) Human Tagged ORF Clone
RC233893

USD 420.00

In Stock

CHIA (Myc-DDK tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_021797) Human Tagged ORF Clone
RG206441

USD 460.00

In Stock

CHIA (GFP-tagged) - Human chitinase, acidic (CHIA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) Human Gene Knockout Kit (CRISPR)
KN406441

USD 1,290.00

2 Weeks

CHIA - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406441 is the updated version of KN206441.
Chia1 Mouse Gene Knockout Kit (CRISPR)
KN503261

USD 1,290.00

2 Weeks

Chia1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503261 is the updated version of KN303261.
Chia (BC011134) Mouse Tagged ORF Clone
MG205616

USD 240.00

3 Weeks

Chia (GFP-tagged) - Mouse chitinase, acidic (cDNA clone MGC:18771 IMAGE:4165150)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chia (BC011134) Mouse Tagged ORF Clone
MR205616L3

USD 420.00

3 Weeks

Lenti ORF clone of Chia (Myc-DDK-tagged) - Mouse chitinase, acidic (cDNA clone MGC:18771 IMAGE:4165150)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chia (BC011134) Mouse Tagged ORF Clone Lentiviral Particle
MR205616L3V

USD 620.00

6 Weeks

Lenti ORF particles, Chia (Myc-DDK-tagged) - Mouse chitinase, acidic (cDNA clone MGC:18771 IMAGE:4165150), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chia (BC011134) Mouse Tagged ORF Clone
MR205616L4

USD 420.00

3 Weeks

Lenti ORF clone of Chia (mGFP-tagged) - Mouse chitinase, acidic (cDNA clone MGC:18771 IMAGE:4165150)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chia (BC011134) Mouse Tagged ORF Clone Lentiviral Particle
MR205616L4V

USD 620.00

6 Weeks

Lenti ORF particles, Chia (GFP-tagged) - Mouse chitinase, acidic (cDNA clone MGC:18771 IMAGE:4165150), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AMCase (CHIA) (NM_021797) Human Tagged ORF Clone
RC206441L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chitinase, acidic (CHIA), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AMCase (CHIA) (NM_021797) Human Tagged ORF Clone
RC206441L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chitinase, acidic (CHIA), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AMCase (CHIA) (NM_201653) Human Tagged ORF Clone
RC221549L3

USD 650.00

3 Weeks

Lenti ORF clone of Human chitinase, acidic (CHIA), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AMCase (CHIA) (NM_201653) Human Tagged ORF Clone
RC221549L4

USD 650.00

3 Weeks

Lenti ORF clone of Human chitinase, acidic (CHIA), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AMCase (CHIA) (NM_001040623) Human Tagged ORF Clone
RC233733

USD 420.00

3 Weeks

CHIA (Myc-DDK tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258002) Human Tagged ORF Clone
RC233736

USD 420.00

3 Weeks

CHIA (Myc-DDK tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258004) Human Tagged ORF Clone
RC233737

USD 420.00

3 Weeks

CHIA (Myc-DDK tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258005) Human Tagged ORF Clone
RC233738

USD 420.00

3 Weeks

CHIA (Myc-DDK tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_201653) Human Tagged ORF Clone
RG221549

USD 500.00

3 Weeks

CHIA (GFP-tagged) - Human chitinase, acidic (CHIA), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001040623) Human Tagged ORF Clone
RG233733

USD 460.00

3 Weeks

CHIA (GFP-tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258002) Human Tagged ORF Clone
RG233736

USD 460.00

3 Weeks

CHIA (GFP-tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258004) Human Tagged ORF Clone
RG233737

USD 460.00

3 Weeks

CHIA (GFP-tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258005) Human Tagged ORF Clone
RG233738

USD 460.00

3 Weeks

CHIA (GFP-tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258001) Human Tagged ORF Clone
RG233892

USD 460.00

3 Weeks

CHIA (GFP-tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AMCase (CHIA) (NM_001258003) Human Tagged ORF Clone
RG233893

USD 460.00

3 Weeks

CHIA (GFP-tagged) - Homo sapiens chitinase, acidic (CHIA), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chia (NM_207586) Rat Tagged ORF Clone
RR201701

USD 650.00

4 Weeks

Chia (Myc-DDK-tagged ORF) - Rat chitinase, acidic (Chia), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Chia (NM_207586) Rat Tagged ORF Clone
RR201701L3

USD 840.00

9 Weeks

Lenti ORF clone of Chia (Myc-DDK-tagged ORF) - Rat chitinase, acidic (Chia), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chia (NM_207586) Rat Tagged ORF Clone Lentiviral Particle
RR201701L3V

USD 1,060.00

13 Weeks

Lenti ORF particles, Chia (Myc-DDK-tagged ORF) - Rat chitinase, acidic (Chia), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chia (NM_207586) Rat Tagged ORF Clone
RR201701L4

USD 920.00

9 Weeks

Lenti ORF clone of Chia (mGFP-tagged ORF) - Rat chitinase, acidic (Chia), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chia (NM_207586) Rat Tagged ORF Clone Lentiviral Particle
RR201701L4V

USD 1,180.00

13 Weeks

Lenti ORF particles, Chia (GFP-tagged ORF) - Rat chitinase, acidic (Chia), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AMCase (CHIA) (NM_021797) Human Recombinant Protein
TP760630

USD 215.00

In Stock

Purified recombinant protein of Human chitinase, acidic (CHIA), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
AMCase (CHIA) (NM_201653) Human Untagged Clone
SC308086

USD 810.00

In Stock

CHIA (untagged)-Human chitinase, acidic (CHIA), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
AMCase (CHIA) (N-term) Rabbit Polyclonal Antibody
AP50895PU-N

USD 450.00

2 Weeks

AMCase (CHIA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 20-47 amino acids from the N-terminal region of human CHIA.
AMCase (CHIA) (NM_021797) Human Untagged Clone
SC304955

USD 760.00

In Stock

CHIA (untagged)-Human chitinase, acidic (CHIA), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
AMCase (CHIA) (NM_201653) Human Untagged Clone
SC317787

USD 810.00

In Stock

CHIA (untagged)-Human chitinase, acidic (CHIA), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
AMCase (CHIA) (NM_201653) Human Tagged ORF Clone
RC221549L2

USD 650.00

3 Weeks

Lenti ORF clone of Human chitinase, acidic (CHIA), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
AMCase (CHIA) (NM_001040623) Human Untagged Clone
SC311178

USD 660.00

In Stock

CHIA (untagged)-Human chitinase, acidic (CHIA), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
AMCase (CHIA) (NM_021797) Human Over-expression Lysate
LY411918

USD 396.00

5 Days

Transient overexpression lysate of chitinase, acidic (CHIA), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AMCase (CHIA) Human qPCR Primer Pair (NM_201653)
HP232455

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CHIA

AMCase (CHIA) Rabbit Polyclonal Antibody
TA329462

USD 375.00

5 Days

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
AMCase (CHIA) Rabbit Polyclonal Antibody
TA329463

USD 375.00

5 Days

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP