Germany
Japan
United Kingdom
China
CLPTM1L (GFP-tagged) - Human CLPTM1-like (CLPTM1L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadClptm1l (Myc-DDK-tagged) - Mouse CLPTM1-like (Clptm1l)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CLPTM1L - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN406866 is the updated version of KN206866.
Clptm1l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503488 is the updated version of KN303488.
Clptm1l (GFP-tagged) - Mouse CLPTM1-like (Clptm1l)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Clptm1l (Myc-DDK-tagged) - Mouse CLPTM1-like (Clptm1l)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Clptm1l (Myc-DDK-tagged) - Mouse CLPTM1-like (Clptm1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Clptm1l (mGFP-tagged) - Mouse CLPTM1-like (Clptm1l)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Clptm1l (GFP-tagged) - Mouse CLPTM1-like (Clptm1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CLPTM1L (Myc-DDK-tagged)-Human CLPTM1-like (CLPTM1L)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CLPTM1L (Myc-DDK-tagged)-Human CLPTM1-like (CLPTM1L)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CLPTM1L (Myc-DDK-tagged)-Human CLPTM1-like (CLPTM1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CLPTM1L (mGFP-tagged)-Human CLPTM1-like (CLPTM1L)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CLPTM1L (mGFP-tagged)-Human CLPTM1-like (CLPTM1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Clptm1l (Myc-DDK-tagged ORF) - Rat CLPTM1-like (Clptm1l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Clptm1l (Myc-DDK-tagged ORF) - Rat CLPTM1-like (Clptm1l), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Clptm1l (Myc-DDK-tagged ORF) - Rat CLPTM1-like (Clptm1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Clptm1l (mGFP-tagged ORF) - Rat CLPTM1-like (Clptm1l), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Clptm1l (GFP-tagged ORF) - Rat CLPTM1-like (Clptm1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CLPTM1L (untagged)-Human CLPTM1-like (CLPTM1L)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CLPTM1L (untagged)-Human CLPTM1-like (CLPTM1L)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CLPTM1L (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR325162 is the updated version of SR312994.
CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected between amino acids 508-538 of human CLPTM1L |
Clptm1l (untagged) - Mouse CLPTM1-like (Clptm1l), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CLPTM1L (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 369-399 amino acids from the C-terminal region of human CLPTM1L |
Rabbit Polyclonal Anti-CLPTM1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLPTM1L antibody: synthetic peptide directed towards the middle region of human CLPTM1L. Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD |
CLPTM1L CRISPRa kit - CRISPR gene activation of human CLPTM1 like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Clptm1l CRISPRa kit - CRISPR gene activation of mouse CLPTM1-like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CLPTM1L
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CLPTM1L
qPCR primer pairs and template standards against Mus musculus gene C130052I12Rik
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Clptm1l
Clptm1l (untagged ORF) - Rat CLPTM1-like (Clptm1l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of CLPTM1-like (CLPTM1L) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Clptm1l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Clptm1l (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of CLPTM1L (NM_030782) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CLPTM1L - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
CLPTM1L - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Clptm1l - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Clptm1l - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Clptm1l - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Clptm1l - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
CLPTM1L - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Clptm1l - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Clptm1l - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of CLPTM1L (NM_030782) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CLPTM1L