Products

cDNA Clones (35)
Proteins (16)
Gene Expression (11)
RNAi (11)
Antibodies (5)
Jump to Filters
View as table Download
FECH (NM_001012515) Human Tagged ORF Clone
RC215223

USD 420.00

In Stock

FECH (Myc-DDK-tagged)-Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FECH (NM_000140) Human Tagged ORF Clone
RC208058

USD 420.00

In Stock

FECH (Myc-DDK-tagged)-Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FECH (NM_000140) Human Tagged ORF Clone Lentiviral Particle
RC208058L1V

USD 820.00

3 Weeks

Lenti ORF particles, FECH (Myc-DDK tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FECH (NM_000140) Human Tagged ORF Clone Lentiviral Particle
RC208058L2V

USD 820.00

6 Weeks

Lenti ORF particles, FECH (mGFP-tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone Lentiviral Particle
RC215223L1V

USD 820.00

3 Weeks

Lenti ORF particles, FECH (Myc-DDK tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone Lentiviral Particle
RC215223L2V

USD 820.00

3 Weeks

Lenti ORF particles, FECH (mGFP-tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Fech (NM_007998) Mouse Tagged ORF Clone
MR226253

USD 300.00

In Stock

Fech (Myc-DDK-tagged) - Mouse ferrochelatase (Fech), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Fech (NM_001108434) Rat Tagged ORF Clone
RR213071

USD 420.00

In Stock

Fech (Myc-DDK-tagged ORF) - Rat ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FECH (NM_000140) Human Tagged ORF Clone
RG208058

USD 460.00

In Stock

FECH (GFP-tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FECH Human Gene Knockout Kit (CRISPR)
KN408058

USD 1,290.00

2 Weeks

FECH - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN408058 is the updated version of KN208058.
Fech Mouse Gene Knockout Kit (CRISPR)
KN505890

USD 1,290.00

2 Weeks

Fech - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN505890 is the updated version of KN305890.
Fech (NM_007998) Mouse Tagged ORF Clone
MG226253

USD 330.00

3 Weeks

Fech (GFP-tagged) - Mouse ferrochelatase (Fech) nuclear gene encoding mitochondrial protein, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fech (NM_007998) Mouse Tagged ORF Clone
MR226253L3

USD 500.00

3 Weeks

Lenti ORF clone of Fech (Myc-DDK-tagged) - Mouse ferrochelatase (Fech), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fech (NM_007998) Mouse Tagged ORF Clone Lentiviral Particle
MR226253L3V

USD 700.00

6 Weeks

Lenti ORF particles, Fech (Myc-DDK-tagged) - Mouse ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fech (NM_007998) Mouse Tagged ORF Clone
MR226253L4

USD 500.00

3 Weeks

Lenti ORF clone of Fech (mGFP-tagged) - Mouse ferrochelatase (Fech), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Fech (NM_007998) Mouse Tagged ORF Clone Lentiviral Particle
MR226253L4V

USD 700.00

6 Weeks

Lenti ORF particles, Fech (GFP-tagged) - Mouse ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_000140) Human Tagged ORF Clone
RC208058L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_000140) Human Tagged ORF Clone Lentiviral Particle
RC208058L3V

USD 820.00

6 Weeks

Lenti ORF particles, FECH (Myc-DDK tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_000140) Human Tagged ORF Clone
RC208058L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_000140) Human Tagged ORF Clone Lentiviral Particle
RC208058L4V

USD 820.00

6 Weeks

Lenti ORF particles, FECH (mGFP-tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone
RC215223L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone Lentiviral Particle
RC215223L3V

USD 820.00

5 Weeks

Lenti ORF particles, FECH (Myc-DDK tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone
RC215223L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone Lentiviral Particle
RC215223L4V

USD 820.00

5 Weeks

Lenti ORF particles, FECH (mGFP-tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_001012515) Human Tagged ORF Clone
RG215223

USD 460.00

3 Weeks

FECH (GFP-tagged) - Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fech (NM_001108434) Rat Tagged ORF Clone
RR213071L3

USD 640.00

4 Weeks

Lenti ORF clone of Fech (Myc-DDK-tagged ORF) - Rat ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fech (NM_001108434) Rat Tagged ORF Clone Lentiviral Particle
RR213071L3V

USD 850.00

8 Weeks

Lenti ORF particles, Fech (Myc-DDK-tagged ORF) - Rat ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fech (NM_001108434) Rat Tagged ORF Clone
RR213071L4

USD 700.00

4 Weeks

Lenti ORF clone of Fech (mGFP-tagged ORF) - Rat ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Fech (NM_001108434) Rat Tagged ORF Clone Lentiviral Particle
RR213071L4V

USD 960.00

8 Weeks

Lenti ORF particles, Fech (GFP-tagged ORF) - Rat ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FECH (NM_001012515) Human Tagged Lenti ORF Clone
RC215223L1

USD 768.00

In Stock

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FECH (NM_001012515) Human Tagged Lenti ORF Clone
RC215223L2

USD 768.00

In Stock

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FECH Rabbit Polyclonal Antibody
TA372561

USD 380.00

4 Weeks

FECH rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FECH
FECH Rabbit Polyclonal Antibody
TA346251

USD 475.00

5 Days

Rabbit Polyclonal Anti-FECH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FECH antibody: synthetic peptide directed towards the N terminal of human FECH. Synthetic peptide located within the following region: QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL
FECH (NM_000140) Human Tagged ORF Clone
RC208058L1

USD 768.00

In Stock

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FECH Rabbit Polyclonal Antibody
TA346162

USD 410.00

5 Days

Rabbit Polyclonal Anti-FECH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FECH antibody: synthetic peptide directed towards the N terminal of human FECH. Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM
FECH Rabbit Polyclonal Antibody
TA346163

USD 475.00

5 Days

Rabbit Polyclonal Anti-FECH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FECH antibody: synthetic peptide directed towards the middle region of human FECH. Synthetic peptide located within the following region: KRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVW
Fech Rat shRNA Plasmid (Locus ID 361338)
TL706970

USD 815.00

In Stock

Fech - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Fech (NM_007998) Mouse Untagged Clone
MC208477

USD 420.00

In Stock

Fech (untagged) - Mouse ferrochelatase (Fech), nuclear gene encoding mitochondrial protein, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FECH (NM_000140) Human Tagged ORF Clone
RC208058L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FECH (NM_000140) Human Untagged Clone
SC125310

USD 310.00

In Stock

FECH (untagged)-Human ferrochelatase (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
FECH Human Gene Knockout Kit (CRISPR)
KN208058

USD 1,290.00

2 Weeks

FECH - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
FECH (NM_000140) Human Over-expression Lysate
LY400049

USD 396.00

5 Days

Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FECH (NM_001012515) Human Over-expression Lysate
LY425320

USD 396.00

5 Days

Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Human FECH activation kit by CRISPRa
GA101561

USD 1,290.00

2 Weeks

FECH CRISPRa kit - CRISPR gene activation of human ferrochelatase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Fech activation kit by CRISPRa
GA201382

USD 1,290.00

2 Weeks

Fech CRISPRa kit - CRISPR gene activation of mouse ferrochelatase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
FECH Human qPCR Template Standard (NM_000140)
HK203073

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene FECH

Application Plasmid of exact quantity for transcript copy number calculation
FECH Human qPCR Primer Pair (NM_000140)
HP200125

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene FECH

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
FECH Human Gene Knockout Kit (CRISPR)
KN208058BN

USD 1,290.00

4 Weeks

FECH - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA mBFP-Neo
FECH Human Gene Knockout Kit (CRISPR)
KN208058LP

USD 1,290.00

4 Weeks

FECH - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA Luciferase-Puro