Products

cDNA Clones (49)
Proteins (17)
Antibodies (12)
RNAi (11)
Gene Expression (8)
Jump to Filters
View as table Download
FOXP4 (NM_001012426) Human Tagged ORF Clone
RC208611

USD 420.00

In Stock

FOXP4 (Myc-DDK-tagged)-Human forkhead box P4 (FOXP4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FOXP4 (NM_138457) Human Tagged ORF Clone
RC208077

USD 420.00

In Stock

FOXP4 (Myc-DDK-tagged)-Human forkhead box P4 (FOXP4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FOXP4 (NM_138457) Human Recombinant Protein
TP308077

USD 823.00

In Stock

Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Foxp4 (NM_001110824) Mouse Tagged ORF Clone
MR221681

USD 610.00

In Stock

Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXP4 (NM_001012426) Human Recombinant Protein
TP308611

USD 823.00

In Stock

Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
FOXP4 Human Gene Knockout Kit (CRISPR)
KN408077

USD 1,290.00

2 Weeks

FOXP4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN408077 is the updated version of KN208077.
Foxp4 Mouse Gene Knockout Kit (CRISPR)
KN506104

USD 1,290.00

2 Weeks

Foxp4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506104 is the updated version of KN306104.
Foxp4 (BC057110) Mouse Tagged ORF Clone
MG209934

USD 780.00

3 Weeks

Foxp4 (GFP-tagged) - Mouse forkhead box P4 (cDNA clone MGC:61328 IMAGE:6417088)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_001110824) Mouse Tagged ORF Clone
MG221681

USD 670.00

3 Weeks

Foxp4 (GFP-tagged) - Mouse forkhead box P4 (Foxp4) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_001110825) Mouse Tagged ORF Clone
MG221682

USD 780.00

3 Weeks

Foxp4 (GFP-tagged) - Mouse forkhead box P4 (Foxp4) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_028767) Mouse Tagged ORF Clone
MR209934

USD 710.00

5 Weeks

Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_028767) Mouse Tagged ORF Clone
MR209934L3

USD 910.00

10 Weeks

Lenti ORF clone of Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_028767) Mouse Tagged ORF Clone Lentiviral Particle
MR209934L3V

USD 1,110.00

13 Weeks

Lenti ORF particles, Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_028767) Mouse Tagged ORF Clone
MR209934L4

USD 910.00

10 Weeks

Lenti ORF clone of Foxp4 (mGFP-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_028767) Mouse Tagged ORF Clone Lentiviral Particle
MR209934L4V

USD 1,110.00

13 Weeks

Lenti ORF particles, Foxp4 (GFP-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001110824) Mouse Tagged ORF Clone
MR221681L3

USD 810.00

3 Weeks

Lenti ORF clone of Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001110824) Mouse Tagged ORF Clone
MR221681L4

USD 810.00

3 Weeks

Lenti ORF clone of Foxp4 (mGFP-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001110824) Mouse Tagged ORF Clone Lentiviral Particle
MR221681L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, Foxp4 (GFP-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001110825) Mouse Tagged ORF Clone
MR221682

USD 710.00

5 Weeks

Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_001110825) Mouse Tagged ORF Clone
MR221682L3

USD 910.00

4 Weeks

Lenti ORF clone of Foxp4 (Myc-DDK-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001110825) Mouse Tagged ORF Clone
MR221682L4

USD 910.00

4 Weeks

Lenti ORF clone of Foxp4 (mGFP-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001110825) Mouse Tagged ORF Clone Lentiviral Particle
MR221682L4V

USD 1,110.00

7 Weeks

Lenti ORF particles, Foxp4 (GFP-tagged) - Mouse forkhead box P4 (Foxp4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_138457) Human Tagged ORF Clone
RC208077L3

USD 620.00

3 Weeks

Lenti ORF clone of Human forkhead box P4 (FOXP4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_138457) Human Tagged ORF Clone Lentiviral Particle
RC208077L3V

USD 820.00

6 Weeks

Lenti ORF particles, FOXP4 (Myc-DDK tagged) - Human forkhead box P4 (FOXP4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_138457) Human Tagged ORF Clone
RC208077L4

USD 620.00

3 Weeks

Lenti ORF clone of Human forkhead box P4 (FOXP4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_138457) Human Tagged ORF Clone Lentiviral Particle
RC208077L4V

USD 820.00

6 Weeks

Lenti ORF particles, FOXP4 (mGFP-tagged) - Human forkhead box P4 (FOXP4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_001012426) Human Tagged ORF Clone
RC208611L3

USD 620.00

3 Weeks

Lenti ORF clone of Human forkhead box P4 (FOXP4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_001012426) Human Tagged ORF Clone
RC208611L4

USD 620.00

3 Weeks

Lenti ORF clone of Human forkhead box P4 (FOXP4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_001012426) Human Tagged ORF Clone Lentiviral Particle
RC208611L4V

USD 820.00

6 Weeks

Lenti ORF particles, FOXP4 (mGFP-tagged) - Human forkhead box P4 (FOXP4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_001012427) Human Tagged ORF Clone
RC215338

USD 420.00

4 Weeks

FOXP4 (Myc-DDK-tagged)-Human forkhead box P4 (FOXP4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXP4 (NM_001012427) Human Tagged ORF Clone
RC215338L3

USD 620.00

4 Weeks

Lenti-ORF clone of FOXP4 (Myc-DDK-tagged)-Human forkhead box P4 (FOXP4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_001012427) Human Tagged ORF Clone
RC215338L4

USD 620.00

4 Weeks

Lenti-ORF clone of FOXP4 (mGFP-tagged)-Human forkhead box P4 (FOXP4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 (NM_138457) Human Tagged ORF Clone
RG208077

USD 460.00

3 Weeks

FOXP4 (GFP-tagged) - Human forkhead box P4 (FOXP4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXP4 (NM_001012426) Human Tagged ORF Clone
RG208611

USD 460.00

3 Weeks

FOXP4 (GFP-tagged) - Human forkhead box P4 (FOXP4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXP4 (NM_001012427) Human Tagged ORF Clone
RG215338

USD 460.00

5 Weeks

FOXP4 (GFP-tagged) - Human forkhead box P4 (FOXP4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_001108788) Rat Tagged ORF Clone
RR204741

USD 420.00

4 Weeks

Foxp4 (Myc-DDK-tagged ORF) - Rat forkhead box P4 (Foxp4), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Foxp4 (NM_001108788) Rat Tagged ORF Clone
RR204741L3

USD 640.00

8 Weeks

Lenti ORF clone of Foxp4 (Myc-DDK-tagged ORF) - Rat forkhead box P4 (Foxp4), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Foxp4 (NM_001108788) Rat Tagged ORF Clone
RR204741L4

USD 700.00

8 Weeks

Lenti ORF clone of Foxp4 (mGFP-tagged ORF) - Rat forkhead box P4 (Foxp4), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXP4 Rabbit Polyclonal Antibody
TA371690

USD 380.00

4 Weeks

FOXP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXP4
FOXP4 Rabbit Polyclonal Antibody
TA345501

USD 410.00

5 Days

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the C terminal of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE
FOXP4 Rabbit Polyclonal Antibody
TA345500

USD 475.00

5 Days

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the N terminal of human FOXP4. Synthetic peptide located within the following region: MVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGAD
FOXP4 Rabbit Polyclonal Antibody
TA347829

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FOXP4 (NM_001012426) Human Untagged Clone
SC301657

USD 760.00

In Stock

FOXP4 (untagged)-Human forkhead box P4 (FOXP4), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None