Products

View as table Download

GTF2IRD1 (Myc-DDK-tagged)-Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GTF2IRD1 (Myc-DDK-tagged)-Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, GTF2IRD1 (Myc-DDK tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, GTF2IRD1 (mGFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Recombinant protein of human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

GTF2IRD1 (GFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GTF2IRD1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402128 is the updated version of KN202128.

Gtf2ird1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507427 is the updated version of KN307427.

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 3, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 6, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 7, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 8, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 9, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 10, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gtf2ird1 (mGFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 10

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 11

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2IRD1 (Myc-DDK tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2IRD1 (mGFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2IRD1 (Myc-DDK tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2IRD1 (mGFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GTF2IRD1 (Myc-DDK tagged) - Homo sapiens GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

GTF2IRD1 (GFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GTF2IRD1 (GFP-tagged) - Homo sapiens GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Gtf2ird1 (Myc-DDK-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Gtf2ird1 (Myc-DDK-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Gtf2ird1 (mGFP-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Gtf2ird1 (GFP-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-GTF2IRD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the N terminal of human GTF2IRD1. Synthetic peptide located within the following region: MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNA