GTF2IRD1 (Myc-DDK-tagged)-Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2IRD1 (Myc-DDK-tagged)-Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2IRD1 (Myc-DDK-tagged)-Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GTF2IRD1 (Myc-DDK tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GTF2IRD1 (mGFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
GTF2IRD1 (GFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2IRD1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Gtf2ird1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 1, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 2, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 3, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 6, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 7, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 8, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 9, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1) transcript variant 10, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Gtf2ird1 (mGFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2ird1 (GFP-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 8, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 10
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (myc-DDK-tagged) - Mouse general transcription factor II I repeat domain-containing 1 (Gtf2ird1), transcript variant 11
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2IRD1 (Myc-DDK tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2IRD1 (mGFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2IRD1 (Myc-DDK tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2IRD1 (mGFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GTF2IRD1 (Myc-DDK tagged) - Homo sapiens GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2IRD1 (GFP-tagged) - Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GTF2IRD1 (GFP-tagged) - Homo sapiens GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2ird1 (Myc-DDK-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Gtf2ird1 (Myc-DDK-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2ird1 (Myc-DDK-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Gtf2ird1 (mGFP-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2ird1 (GFP-tagged ORF) - Rat GTF2I repeat domain containing 1 (Gtf2ird1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GTF2IRD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the N terminal of human GTF2IRD1. Synthetic peptide located within the following region: MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNA |