Products

cDNA Clones (47)
Proteins (25)
RNAi (13)
Antibodies (9)
Gene Expression (8)
Jump to Filters
View as table Download
HMGB2 (NM_002129) Human Tagged ORF Clone
RC200750

USD 98.00

USD 390.00

In Stock

HMGB2 (Myc-DDK-tagged)-Human high mobility group box 2 (HMGB2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HMGB2 (NM_001130688) Human Tagged ORF Clone
RC225239

USD 420.00

In Stock

HMGB2 (Myc-DDK-tagged)-Human high mobility group box 2 (HMGB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HMGB2 (NM_001130689) Human Tagged ORF Clone
RC225240

USD 420.00

In Stock

HMGB2 (Myc-DDK-tagged)-Human high mobility group box 2 (HMGB2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HMGB2 (NM_002129) Human Recombinant Protein
TP300750

USD 823.00

In Stock

Recombinant protein of human high-mobility group box 2 (HMGB2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Hmgb2 (BC002050) Mouse Tagged ORF Clone
MR202276

USD 68.00

USD 310.00

In Stock

Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HMGB2 (NM_002129) Human Tagged ORF Clone Lentiviral Particle
RC200750L1V

USD 820.00

3 Weeks

Lenti ORF particles, HMGB2 (Myc-DDK tagged) - Human high mobility group box 2 (HMGB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HMGB2 (NM_002129) Human Tagged ORF Clone Lentiviral Particle
RC200750L2V

USD 820.00

6 Weeks

Lenti ORF particles, HMGB2 (mGFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HMGB2 (NM_002129) Human Tagged ORF Clone
RG200750

USD 460.00

In Stock

HMGB2 (GFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HMGB2 (NM_001130689) Human Tagged ORF Clone
RG225240

USD 460.00

2 Weeks

HMGB2 (GFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HMGB2 Human Gene Knockout Kit (CRISPR)
KN400750

USD 1,290.00

2 Weeks

HMGB2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400750 is the updated version of KN200750.
Hmgb2 Mouse Gene Knockout Kit (CRISPR)
KN507818

USD 1,290.00

2 Weeks

Hmgb2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507818 is the updated version of KN307818.
Hmgb2 (BC046759) Mouse Tagged ORF Clone
MG202266

USD 240.00

3 Weeks

Hmgb2 (GFP-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:57916 IMAGE:5693598)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hmgb2 (BC002050) Mouse Tagged ORF Clone
MG202276

USD 300.00

3 Weeks

Hmgb2 (GFP-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hmgb2 (NM_008252) Mouse Tagged ORF Clone
MR202266

USD 220.00

2 Weeks

Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (Hmgb2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hmgb2 (NM_008252) Mouse Tagged ORF Clone
MR202266L3

USD 420.00

3 Weeks

Lenti ORF clone of Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (Hmgb2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (NM_008252) Mouse Tagged ORF Clone
MR202266L4

USD 420.00

3 Weeks

Lenti ORF clone of Hmgb2 (mGFP-tagged) - Mouse high mobility group box 2 (Hmgb2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (NM_008252) Mouse Tagged ORF Clone Lentiviral Particle
MR202266L4V

USD 620.00

6 Weeks

Lenti ORF particles, Hmgb2 (GFP-tagged) - Mouse high mobility group box 2 (Hmgb2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (BC002050) Mouse Tagged ORF Clone
MR202276L3

USD 500.00

3 Weeks

Lenti ORF clone of Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (BC002050) Mouse Tagged ORF Clone Lentiviral Particle
MR202276L3V

USD 700.00

6 Weeks

Lenti ORF particles, Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (BC002050) Mouse Tagged ORF Clone
MR202276L4

USD 500.00

3 Weeks

Lenti ORF clone of Hmgb2 (mGFP-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (BC002050) Mouse Tagged ORF Clone Lentiviral Particle
MR202276L4V

USD 700.00

6 Weeks

Lenti ORF particles, Hmgb2 (GFP-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_002129) Human Tagged ORF Clone
RC200750L3

USD 620.00

3 Weeks

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_002129) Human Tagged ORF Clone Lentiviral Particle
RC200750L3V

USD 820.00

5 Weeks

Lenti ORF particles, HMGB2 (Myc-DDK tagged) - Human high mobility group box 2 (HMGB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_002129) Human Tagged ORF Clone Lentiviral Particle
RC200750L4V

USD 820.00

3 Weeks

Lenti ORF particles, HMGB2 (mGFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130688) Human Tagged ORF Clone
RC225239L3

USD 620.00

3 Weeks

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130688) Human Tagged ORF Clone Lentiviral Particle
RC225239L3V

USD 820.00

6 Weeks

Lenti ORF particles, HMGB2 (Myc-DDK tagged) - Human high mobility group box 2 (HMGB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130688) Human Tagged ORF Clone
RC225239L4

USD 620.00

3 Weeks

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130688) Human Tagged ORF Clone Lentiviral Particle
RC225239L4V

USD 820.00

6 Weeks

Lenti ORF particles, HMGB2 (mGFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130689) Human Tagged ORF Clone
RC225240L3

USD 620.00

3 Weeks

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130689) Human Tagged ORF Clone Lentiviral Particle
RC225240L3V

USD 820.00

6 Weeks

Lenti ORF particles, HMGB2 (Myc-DDK tagged) - Human high mobility group box 2 (HMGB2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130689) Human Tagged ORF Clone
RC225240L4

USD 620.00

3 Weeks

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130689) Human Tagged ORF Clone Lentiviral Particle
RC225240L4V

USD 820.00

6 Weeks

Lenti ORF particles, HMGB2 (mGFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 (NM_001130688) Human Tagged ORF Clone
RG225239

USD 460.00

3 Weeks

HMGB2 (GFP-tagged) - Human high mobility group box 2 (HMGB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hmgb2 (NM_017187) Rat Tagged ORF Clone
RR202856

USD 420.00

4 Weeks

Hmgb2 (Myc-DDK-tagged ORF) - Rat high mobility group box 2 (Hmgb2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hmgb2 (NM_017187) Rat Tagged ORF Clone
RR202856L3

USD 640.00

9 Weeks

Lenti ORF clone of Hmgb2 (Myc-DDK-tagged ORF) - Rat high mobility group box 2 (Hmgb2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (NM_017187) Rat Tagged ORF Clone Lentiviral Particle
RR202856L3V

USD 850.00

13 Weeks

Lenti ORF particles, Hmgb2 (Myc-DDK-tagged ORF) - Rat high mobility group box 2 (Hmgb2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (NM_017187) Rat Tagged ORF Clone
RR202856L4

USD 700.00

9 Weeks

Lenti ORF clone of Hmgb2 (mGFP-tagged ORF) - Rat high mobility group box 2 (Hmgb2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hmgb2 (NM_017187) Rat Tagged ORF Clone Lentiviral Particle
RR202856L4V

USD 960.00

13 Weeks

Lenti ORF particles, Hmgb2 (GFP-tagged ORF) - Rat high mobility group box 2 (Hmgb2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HMGB2 Rabbit Polyclonal Antibody
TA344432

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS
HMGB2 (NM_002129) Human Tagged ORF Clone
RC200750L1

USD 768.00

In Stock

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HMGB2 (NM_002129) Human Recombinant Protein
TP720732

USD 330.00

3 Weeks

Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 1

Tag C-His
Expression Host HEK293
HMGB2 Mouse Monoclonal Antibody [Clone ID: 3D2]
AM20899PU-N

USD 480.00

2 Weeks

HMGB2 mouse monoclonal antibody, clone 3D2

Applications ELISA, IF, IHC, WB
Reactivities Human
Hmgb2 (NM_008252) Mouse Untagged Clone
MC202770

USD 210.00

In Stock

Hmgb2 (untagged) - Mouse high mobility group box 2 (Hmgb2), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
HMGB2 (NM_001130688) Human Untagged Clone
SC324790

USD 420.00

In Stock

HMGB2 (untagged)-Human high mobility group box 2 (HMGB2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
HMGB2 Rabbit Polyclonal Antibody
TA344431

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE
HMGB2 Mouse Monoclonal Antibody [Clone ID: 3C7]
AM20898PU-N

USD 480.00

2 Weeks

HMGB2 mouse monoclonal antibody, clone 3C7

Applications ELISA, IHC, WB
Reactivities Human
HMGB2 (NM_002129) Human Tagged ORF Clone
RC200750L2

USD 620.00

3 Weeks

Lenti ORF clone of Human high mobility group box 2 (HMGB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®