Products

cDNA Clones (47)
Proteins (21)
RNAi (12)
Gene Expression (8)
Antibodies (6)
Jump to Filters
View as table Download
ICA1 (NM_004968) Human Tagged ORF Clone
RC202149

USD 420.00

In Stock

ICA1 (Myc-DDK-tagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ICA1 (NM_022307) Human Tagged ORF Clone
RC213136

USD 420.00

In Stock

ICA1 (Myc-DDK-tagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ICA1 (NM_001136020) Human Tagged ORF Clone
RC226813

USD 420.00

In Stock

ICA1 (Myc-DDK-tagged)-Human islet cell autoantigen 1, 69kDa (ICA1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ICA1 (NM_004968) Human Tagged ORF Clone Lentiviral Particle
RC202149L1V

USD 820.00

3 Weeks

Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ICA1 (NM_004968) Human Tagged ORF Clone Lentiviral Particle
RC202149L2V

USD 820.00

6 Weeks

Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Ica1 (NM_010492) Mouse Tagged ORF Clone
MR207669

USD 350.00

In Stock

Ica1 (Myc-DDK-tagged) - Mouse islet cell autoantigen 1 (Ica1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ICA1 (NM_004968) Human Tagged ORF Clone
RG202149

USD 460.00

In Stock

ICA1 (GFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ICA1 (NM_022307) Human Tagged ORF Clone
RG213136

USD 460.00

In Stock

ICA1 (GFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ICA1 Human Gene Knockout Kit (CRISPR)
KN402149

USD 1,290.00

2 Weeks

ICA1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402149 is the updated version of KN202149.
Ica1 Mouse Gene Knockout Kit (CRISPR)
KN508067

USD 1,290.00

2 Weeks

Ica1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN508067 is the updated version of KN308067.
Ica1 (NM_010492) Mouse Tagged ORF Clone
MG207669

USD 390.00

3 Weeks

Ica1 (GFP-tagged) - Mouse islet cell autoantigen 1 (Ica1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ica1 (NM_010492) Mouse Tagged ORF Clone
MR207669L3

USD 550.00

3 Weeks

Lenti ORF clone of Ica1 (Myc-DDK-tagged) - Mouse islet cell autoantigen 1 (Ica1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ica1 (NM_010492) Mouse Tagged ORF Clone
MR207669L4

USD 550.00

3 Weeks

Lenti ORF clone of Ica1 (mGFP-tagged) - Mouse islet cell autoantigen 1 (Ica1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ica1 (NM_010492) Mouse Tagged ORF Clone Lentiviral Particle
MR207669L4V

USD 750.00

6 Weeks

Lenti ORF particles, Ica1 (GFP-tagged) - Mouse islet cell autoantigen 1 (Ica1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ica1 (NM_001252266) Mouse Tagged ORF Clone
MR230004

USD 480.00

2 Weeks

Ica1 (myc-DDK-tagged) - Mouse islet cell autoantigen 1 (Ica1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ICA1 (NM_004968) Human Tagged ORF Clone
RC202149L3

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_004968) Human Tagged ORF Clone Lentiviral Particle
RC202149L3V

USD 820.00

5 Weeks

Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_004968) Human Tagged ORF Clone
RC202149L4

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_004968) Human Tagged ORF Clone Lentiviral Particle
RC202149L4V

USD 820.00

7 Weeks

Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_022307) Human Tagged ORF Clone
RC213136L3

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_022307) Human Tagged ORF Clone Lentiviral Particle
RC213136L3V

USD 820.00

6 Weeks

Lenti ORF particles, ICA1 (Myc-DDK tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_022307) Human Tagged ORF Clone
RC213136L4

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_022307) Human Tagged ORF Clone Lentiviral Particle
RC213136L4V

USD 820.00

6 Weeks

Lenti ORF particles, ICA1 (mGFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_001136020) Human Tagged ORF Clone
RC226813L3

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_001136020) Human Tagged ORF Clone
RC226813L4

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_001276478) Human Tagged ORF Clone
RC232828

USD 510.00

3 Weeks

ICA1 (Myc-DDK tagged) - Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ICA1 (NM_001136020) Human Tagged ORF Clone
RG226813

USD 460.00

3 Weeks

ICA1 (GFP-tagged) - Human islet cell autoantigen 1, 69kDa (ICA1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ICA1 (NM_001276478) Human Tagged ORF Clone
RG232828

USD 560.00

3 Weeks

ICA1 (GFP-tagged) - Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ica1 (NM_030844) Rat Tagged ORF Clone
RR213359

USD 650.00

4 Weeks

Ica1 (Myc-DDK-tagged ORF) - Rat islet cell autoantigen 1 (Ica1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ica1 (NM_030844) Rat Tagged ORF Clone
RR213359L3

USD 850.00

8 Weeks

Lenti ORF clone of Ica1 (Myc-DDK-tagged ORF) - Rat islet cell autoantigen 1 (Ica1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ica1 (NM_030844) Rat Tagged ORF Clone Lentiviral Particle
RR213359L3V

USD 1,070.00

12 Weeks

Lenti ORF particles, Ica1 (Myc-DDK-tagged ORF) - Rat islet cell autoantigen 1 (Ica1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ica1 (NM_030844) Rat Tagged ORF Clone
RR213359L4

USD 930.00

8 Weeks

Lenti ORF clone of Ica1 (mGFP-tagged ORF) - Rat islet cell autoantigen 1 (Ica1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ica1 (NM_030844) Rat Tagged ORF Clone Lentiviral Particle
RR213359L4V

USD 1,190.00

12 Weeks

Lenti ORF particles, Ica1 (GFP-tagged ORF) - Rat islet cell autoantigen 1 (Ica1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ICA1 (NM_004968) Human Tagged ORF Clone
RC202149L1

USD 768.00

In Stock

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ICA1 (NM_022307) Human Untagged Clone
SC112522

USD 310.00

In Stock

ICA1 (untagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ICA1 (NM_004968) Human Tagged ORF Clone
RC202149L2

USD 620.00

3 Weeks

Lenti ORF clone of Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ICA1 (NM_004968) Human Untagged Clone
SC117057

USD 760.00

In Stock

ICA1 (untagged)-Human islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ICA1 Human siRNA Oligo Duplex (Locus ID 3382)
SR302293

USD 430.00

In Stock

ICA1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

ICA1 Rabbit Polyclonal Antibody
TA335083

USD 375.00

5 Days

Rabbit Polyclonal Anti-ICA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the N terminal of human ICA1. Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS
ICA1 (N-term) Rabbit Polyclonal Antibody
AP52139PU-N

USD 450.00

2 Weeks

ICA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 83-111 amino acids from the N-terminal region of human Islet cell autoantigen 1 / ICA1
ICA1 (NM_022307) Human Over-expression Lysate
LY402921

USD 396.00

5 Days

Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ICA1 (NM_004968) Human Over-expression Lysate
LY417620

USD 396.00

5 Days

Transient overexpression lysate of islet cell autoantigen 1, 69kDa (ICA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ICA1 Rabbit Polyclonal Antibody
TA335084

USD 375.00

5 Days

Rabbit Polyclonal Anti-ICA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the C terminal of human ICA1. Synthetic peptide located within the following region: NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA
Human ICA1 activation kit by CRISPRa
GA102298

USD 1,290.00

2 Weeks

ICA1 CRISPRa kit - CRISPR gene activation of human islet cell autoantigen 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Ica1 activation kit by CRISPRa
GA202046

USD 1,290.00

2 Weeks

Ica1 CRISPRa kit - CRISPR gene activation of mouse islet cell autoantigen 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ICA1 Human qPCR Template Standard (NM_022307)
HK203889

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene ICA1

Application Plasmid of exact quantity for transcript copy number calculation