Germany
Japan
United Kingdom
China
IGFBP7 (Myc-DDK-tagged)-Human insulin-like growth factor binding protein 7 (IGFBP7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
IGFBP7 (untagged)-Human insulin-like growth factor binding protein 7 (IGFBP7)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Igfbp7 (Myc-DDK-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Igfbp7 (Myc-DDK-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IGFBP7 (Myc-DDK tagged) - Human insulin-like growth factor binding protein 7 (IGFBP7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IGFBP7 (mGFP-tagged) - Human insulin-like growth factor binding protein 7 (IGFBP7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IGFBP7 (GFP-tagged) - Human insulin-like growth factor binding protein 7 (IGFBP7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human insulin-like growth factor binding protein 7 (IGFBP7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
IGFBP7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409844 is the updated version of KN209844.
Igfbp7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508184 is the updated version of KN308184.
Igfbp7 (GFP-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Igfbp7 (GFP-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Igfbp7 (Myc-DDK-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igfbp7 (Myc-DDK-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Igfbp7 (mGFP-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igfbp7 (GFP-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Igfbp7 (Myc-DDK-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igfbp7 (Myc-DDK-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Igfbp7 (mGFP-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igfbp7 (GFP-tagged) - Mouse insulin-like growth factor binding protein 7 (Igfbp7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human insulin-like growth factor binding protein 7 (IGFBP7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IGFBP7 (Myc-DDK tagged) - Human insulin-like growth factor binding protein 7 (IGFBP7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human insulin-like growth factor binding protein 7 (IGFBP7), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IGFBP7 (mGFP-tagged) - Human insulin-like growth factor binding protein 7 (IGFBP7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IGFBP7 (Myc-DDK tagged) - Homo sapiens insulin-like growth factor binding protein 7 (IGFBP7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IGFBP7 (GFP-tagged) - Homo sapiens insulin-like growth factor binding protein 7 (IGFBP7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Igfbp7 (Myc-DDK-tagged ORF) - Rat insulin-like growth factor binding protein 7 (Igfbp7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Igfbp7 (Myc-DDK-tagged ORF) - Rat insulin-like growth factor binding protein 7 (Igfbp7), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igfbp7 (Myc-DDK-tagged ORF) - Rat insulin-like growth factor binding protein 7 (Igfbp7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Igfbp7 (mGFP-tagged ORF) - Rat insulin-like growth factor binding protein 7 (Igfbp7), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igfbp7 (GFP-tagged ORF) - Rat insulin-like growth factor binding protein 7 (Igfbp7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human insulin-like growth factor binding protein 7 (IGFBP7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human insulin-like growth factor binding protein 7 (IGFBP7), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IGFBP7 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-IGFBP7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGFBP7 antibody: synthetic peptide directed towards the C terminal of human IGFBP7. Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH |
Human IGFBP7 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human IGFBP7 |
| Reactivities | Human |
IGFBP7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Igfbp7 (untagged ORF) - Rat insulin-like growth factor binding protein 7 (Igfbp7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IGFBP7 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
IGFBP7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human insulin-like growth factor binding protein 7 (IGFBP7).
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of insulin-like growth factor binding protein 7 (IGFBP7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
IGFBP7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
qSTAR qPCR primer pairs against Homo sapiens gene IGFBP7
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Goat Anti-IGFBP7 (aa145-159) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EKAITQVSKGTCEQG, from the internal region of the protein sequence according to NP_001544.1. |
IGFBP7 (27-282, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
IGFBP7 (27-282, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of monkey primate IGFBP7. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Monkey IGFBP7 |
| Format | 8x12 divisible strips |
| Reactivities | Monkey |
Active filters
Target Symbol
- IGFBP7