Products

cDNA Clones (34)
Proteins (13)
RNAi (12)
Gene Expression (10)
Antibodies (5)
Assay Kits (1)
Jump to Filters
View as table Download
Nectin 3 (NECTIN3) (NM_015480) Human Tagged ORF Clone
RC222962

USD 480.00

In Stock

PVRL3 (Myc-DDK-tagged)-Human poliovirus receptor-related 3 (PVRL3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Nectin3 (NM_021495) Mouse Tagged ORF Clone
MR224209

USD 500.00

In Stock

Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant alpha

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin3 (NM_021497) Mouse Tagged ORF Clone
MG223253

USD 510.00

In Stock

Pvrl3 (GFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3) transcript variant gamma, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin3 (NM_001105883) Rat Tagged ORF Clone
RR203401

USD 690.00

In Stock

Pvrl3 (Myc-DDK-tagged ORF) - Rat poliovirus receptor-related 3 (Pvrl3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin3 (NM_021497) Mouse Tagged ORF Clone
MR223253

USD 460.00

In Stock

Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant gamma

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN422962

USD 1,290.00

2 Weeks

PVRL3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN422962 is the updated version of KN222962.
Nectin3 Mouse Gene Knockout Kit (CRISPR)
KN514269

USD 1,290.00

2 Weeks

Nectin3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514269 is the updated version of KN314269.
Nectin3 (NM_021495) Mouse Tagged ORF Clone
MG224209

USD 550.00

3 Weeks

Pvrl3 (GFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3) transcript variant alpha, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin3 (NM_021496) Mouse Tagged ORF Clone
MG224618

USD 590.00

3 Weeks

Pvrl3 (GFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3) transcript variant beta, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin3 (NM_021497) Mouse Tagged ORF Clone
MR223253L3

USD 660.00

3 Weeks

Lenti ORF clone of Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant gamma

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021497) Mouse Tagged ORF Clone Lentiviral Particle
MR223253L3V

USD 860.00

6 Weeks

Lenti ORF particles, Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant gamma, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021497) Mouse Tagged ORF Clone
MR223253L4

USD 660.00

3 Weeks

Lenti ORF clone of Pvrl3 (mGFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant gamma

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021497) Mouse Tagged ORF Clone Lentiviral Particle
MR223253L4V

USD 860.00

6 Weeks

Lenti ORF particles, Pvrl3 (GFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant gamma, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021495) Mouse Tagged ORF Clone
MR224209L3

USD 700.00

3 Weeks

Lenti ORF clone of Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant alpha

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021495) Mouse Tagged ORF Clone Lentiviral Particle
MR224209L3V

USD 900.00

6 Weeks

Lenti ORF particles, Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021495) Mouse Tagged ORF Clone
MR224209L4

USD 700.00

3 Weeks

Lenti ORF clone of Pvrl3 (mGFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant alpha

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021495) Mouse Tagged ORF Clone Lentiviral Particle
MR224209L4V

USD 900.00

6 Weeks

Lenti ORF particles, Pvrl3 (GFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant alpha, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021496) Mouse Tagged ORF Clone
MR224618

USD 540.00

4 Weeks

Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant beta

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nectin3 (NM_021496) Mouse Tagged ORF Clone
MR224618L3

USD 740.00

8 Weeks

Lenti ORF clone of Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant beta

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021496) Mouse Tagged ORF Clone Lentiviral Particle
MR224618L3V

USD 940.00

11 Weeks

Lenti ORF particles, Pvrl3 (Myc-DDK-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021496) Mouse Tagged ORF Clone
MR224618L4

USD 740.00

8 Weeks

Lenti ORF clone of Pvrl3 (mGFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant beta

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_021496) Mouse Tagged ORF Clone Lentiviral Particle
MR224618L4V

USD 940.00

11 Weeks

Lenti ORF particles, Pvrl3 (GFP-tagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant beta, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin 3 (NECTIN3) (NM_015480) Human Tagged ORF Clone
RC222962L4

USD 680.00

In Stock

Lenti ORF clone of Human poliovirus receptor-related 3 (PVRL3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_001105883) Rat Tagged ORF Clone
RR203401L3

USD 890.00

4 Weeks

Lenti ORF clone of Pvrl3 (Myc-DDK-tagged ORF) - Rat poliovirus receptor-related 3 (Pvrl3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin3 (NM_001105883) Rat Tagged ORF Clone
RR203401L4

USD 970.00

4 Weeks

Lenti ORF clone of Pvrl3 (mGFP-tagged ORF) - Rat poliovirus receptor-related 3 (Pvrl3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nectin 3 (NECTIN3) Rabbit Polyclonal Antibody
TA344114

USD 475.00

5 Days

Rabbit Polyclonal Anti-PVRL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3. Synthetic peptide located within the following region: SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAI
Nectin 3 (NECTIN3) Rabbit Polyclonal Antibody
TA344115

USD 475.00

5 Days

Rabbit Polyclonal Anti-PVRL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3. Synthetic peptide located within the following region: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM
Nectin3 Mouse shRNA Plasmid (Locus ID 58998)
TF503387

USD 715.00

In Stock

Pvrl3 - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
Nectin 3 (NECTIN3) (NM_015480) Human Tagged ORF Clone
RC222962L2

USD 680.00

3 Weeks

Lenti ORF clone of Human poliovirus receptor-related 3 (PVRL3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Nectin 3 (NECTIN3) (NM_015480) Human Over-expression Lysate
LC402442

USD 187.00

In Stock

PVRL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Nectin 3 (NECTIN3) (C-term) Rabbit Polyclonal Antibody
AP53524PU-N

USD 450.00

2 Weeks

Nectin 3 (NECTIN3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 514-544 amino acids from the C-terminal region of Human CD113 / Nectin 3.
Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN222962

USD 1,290.00

4 Weeks

NECTIN3 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Nectin3 Mouse qPCR Primer Pair (NM_021495)
MP211129

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Nectin3

Human Nectin 3 (NECTIN3) ELISA KIT (1 x 96 wells)
EA102645

USD 430.00

3 Weeks

For quantitative detection of human Nectin-3/CD113 in cell culture supernates, serum and plasma (heparin, EDTA).

Assay Type Sandwich ELISA kit of Quantitative Detection for Human Nectin-3/CD113
Format 8x12 divisible strips
Reactivities Human
Human Nectin 3 (NECTIN3) activation kit by CRISPRa
GA108650

USD 1,290.00

2 Weeks

NECTIN3 CRISPRa kit - CRISPR gene activation of human nectin cell adhesion molecule 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Nectin3 activation kit by CRISPRa
GA206322

USD 1,290.00

2 Weeks

Nectin3 CRISPRa kit - CRISPR gene activation of mouse nectin cell adhesion molecule 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Nectin 3 (NECTIN3) Human qPCR Primer Pair (NM_015480)
HP211657

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PVRL3

Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN222962BN

USD 1,290.00

4 Weeks

PVRL3 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA mBFP-Neo
Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN222962LP

USD 1,290.00

4 Weeks

PVRL3 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA Luciferase-Puro
Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN222962RB

USD 1,290.00

4 Weeks

PVRL3 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA RFP-BSD
Nectin3 (NM_021497) Mouse Untagged Clone
MC215827

USD 600.00

4 Weeks

Pvrl3 (untagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant gamma, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Nectin3 (NM_021496) Mouse Untagged Clone
MC217168

USD 690.00

4 Weeks

Pvrl3 (untagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant beta, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Nectin3 (NM_021495) Mouse Untagged Clone
MC218833

USD 740.00

4 Weeks

Pvrl3 (untagged) - Mouse poliovirus receptor-related 3 (Pvrl3), transcript variant alpha, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Nectin3 (NM_001105883) Rat Untagged Clone
RN203401

USD 690.00

5 Weeks

Pvrl3 (untagged ORF) - Rat poliovirus receptor-related 3 (Pvrl3), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin