Germany
Japan
United Kingdom
China
PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PC (mGFP-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PC (mGFP-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pc (Myc-DDK-tagged ORF) - Rat pyruvate carboxylase (Pc), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Pyruvate Carboxylase Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
PC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PC (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pc (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PC - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
PC - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PC - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Goat Polyclonal Antibody against Pyruvate Carboxylase
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KFKEVKKAYVEANQ, from the internal region of the protein sequence according to NP_000911.2; NP_001035806.1; NP_071504.2. |
Rabbit Polyclonal Anti-PC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL |
PC CRISPRa kit - CRISPR gene activation of human pyruvate carboxylase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PC
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PC
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PC
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
PC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY420837 is the same product as LY425729.
Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PC MS Standard C13 and N15-labeled recombinant protein (NP_000911)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Active filters
Target Symbol
- PC