Products

cDNA Clones (50)
Proteins (13)
RNAi (12)
Gene Expression (6)
Antibodies (4)
Jump to Filters
View as table Download
POGZ (NM_145796) Human Tagged ORF Clone
RC217850

USD 1,380.00

In Stock

POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pogz (NM_172683) Mouse Tagged ORF Clone
MR211973

USD 1,140.00

In Stock

Pogz (Myc-DDK-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_207171) Human Tagged ORF Clone
RC213989

USD 1,420.00

In Stock

POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ Human Gene Knockout Kit (CRISPR)
KN413385

USD 1,290.00

2 Weeks

POGZ - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN413385 is the updated version of KN213385.
Pogz Mouse Gene Knockout Kit (CRISPR)
KN513569

USD 1,290.00

2 Weeks

Pogz - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513569 is the updated version of KN313569.
Pogz (NM_172683) Mouse Tagged ORF Clone
MG211973

USD 1,250.00

3 Weeks

Pogz (GFP-tagged) - Mouse pogo transposable element with ZNF domain (Pogz)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pogz (NM_001165948) Mouse Tagged ORF Clone
MG223339

USD 1,620.00

6 Weeks

Pogz (GFP-tagged) - Mouse pogo transposable element with ZNF domain (Pogz) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pogz (NM_172683) Mouse Tagged ORF Clone
MR211973L3

USD 1,340.00

3 Weeks

Lenti ORF clone of Pogz (Myc-DDK-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_172683) Mouse Tagged ORF Clone Lentiviral Particle
MR211973L3V

USD 1,540.00

6 Weeks

Lenti ORF particles, Pogz (Myc-DDK-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_172683) Mouse Tagged ORF Clone
MR211973L4

USD 1,340.00

3 Weeks

Lenti ORF clone of Pogz (mGFP-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_172683) Mouse Tagged ORF Clone Lentiviral Particle
MR211973L4V

USD 1,540.00

6 Weeks

Lenti ORF particles, Pogz (GFP-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_001165948) Mouse Tagged ORF Clone
MR223339

USD 1,470.00

7 Weeks

Pogz (Myc-DDK-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pogz (NM_001165948) Mouse Tagged ORF Clone
MR223339L3

USD 1,670.00

6 Weeks

Lenti ORF clone of Pogz (Myc-DDK-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_001165948) Mouse Tagged ORF Clone Lentiviral Particle
MR223339L3V

USD 1,870.00

9 Weeks

Lenti ORF particles, Pogz (Myc-DDK-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_001165948) Mouse Tagged ORF Clone
MR223339L4

USD 1,670.00

6 Weeks

Lenti ORF clone of Pogz (mGFP-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pogz (NM_001165948) Mouse Tagged ORF Clone Lentiviral Particle
MR223339L4V

USD 1,870.00

9 Weeks

Lenti ORF particles, Pogz (GFP-tagged) - Mouse pogo transposable element with ZNF domain (Pogz), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_015100) Human Tagged ORF Clone
RC213385

USD 1,480.00

6 Weeks

POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_015100) Human Tagged ORF Clone
RC213385L3

USD 1,680.00

6 Weeks

Lenti-ORF clone of POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_015100) Human Tagged ORF Clone Lentiviral Particle
RC213385L3V

USD 1,880.00

9 Weeks

Lenti ORF particles, POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_015100) Human Tagged ORF Clone
RC213385L4

USD 1,680.00

6 Weeks

Lenti-ORF clone of POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_015100) Human Tagged ORF Clone Lentiviral Particle
RC213385L4V

USD 1,880.00

9 Weeks

Lenti ORF particles, POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_207171) Human Tagged ORF Clone
RC213989L3

USD 1,620.00

3 Weeks

Lenti-ORF clone of POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_207171) Human Tagged ORF Clone Lentiviral Particle
RC213989L3V

USD 1,820.00

6 Weeks

Lenti ORF particles, POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_207171) Human Tagged ORF Clone
RC213989L4

USD 1,620.00

3 Weeks

Lenti-ORF clone of POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_207171) Human Tagged ORF Clone Lentiviral Particle
RC213989L4V

USD 1,820.00

6 Weeks

Lenti ORF particles, POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_145796) Human Tagged ORF Clone
RC217850L3

USD 1,580.00

3 Weeks

Lenti-ORF clone of POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_145796) Human Tagged ORF Clone Lentiviral Particle
RC217850L3V

USD 1,780.00

6 Weeks

Lenti ORF particles, POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_145796) Human Tagged ORF Clone
RC217850L4

USD 1,580.00

3 Weeks

Lenti-ORF clone of POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_145796) Human Tagged ORF Clone Lentiviral Particle
RC217850L4V

USD 1,780.00

6 Weeks

Lenti ORF particles, POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194938) Human Tagged ORF Clone
RC231483

USD 1,420.00

6 Weeks

POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_001194938) Human Tagged ORF Clone
RC231483L3

USD 1,620.00

6 Weeks

Lenti-ORF clone of POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194938) Human Tagged ORF Clone Lentiviral Particle
RC231483L3V

USD 1,820.00

9 Weeks

Lenti ORF particles, POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194938) Human Tagged ORF Clone
RC231483L4

USD 1,620.00

6 Weeks

Lenti-ORF clone of POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194938) Human Tagged ORF Clone Lentiviral Particle
RC231483L4V

USD 1,820.00

9 Weeks

Lenti ORF particles, POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194937) Human Tagged ORF Clone
RC231484

USD 1,470.00

6 Weeks

POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_001194937) Human Tagged ORF Clone
RC231484L3

USD 1,670.00

6 Weeks

Lenti-ORF clone of POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194937) Human Tagged ORF Clone Lentiviral Particle
RC231484L3V

USD 1,870.00

9 Weeks

Lenti ORF particles, POGZ (Myc-DDK-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194937) Human Tagged ORF Clone
RC231484L4

USD 1,670.00

6 Weeks

Lenti-ORF clone of POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_001194937) Human Tagged ORF Clone Lentiviral Particle
RC231484L4V

USD 1,870.00

9 Weeks

Lenti ORF particles, POGZ (mGFP-tagged)-Human pogo transposable element with ZNF domain (POGZ), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POGZ (NM_015100) Human Tagged ORF Clone
RG213385

USD 1,630.00

8 Weeks

POGZ (GFP-tagged) - Human pogo transposable element with ZNF domain (POGZ), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_207171) Human Tagged ORF Clone
RG213989

USD 1,560.00

3 Weeks

POGZ (GFP-tagged) - Human pogo transposable element with ZNF domain (POGZ), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_145796) Human Tagged ORF Clone
RG217850

USD 1,520.00

3 Weeks

POGZ (GFP-tagged) - Human pogo transposable element with ZNF domain (POGZ), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_001194938) Human Tagged ORF Clone
RG231483

USD 1,560.00

8 Weeks

POGZ (GFP-tagged) - Human pogo transposable element with ZNF domain (POGZ), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ (NM_001194937) Human Tagged ORF Clone
RG231484

USD 1,620.00

8 Weeks

POGZ (GFP-tagged) - Human pogo transposable element with ZNF domain (POGZ), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pogz (NM_001107693) Rat Tagged ORF Clone
RR203448

USD 2,300.00

7 Weeks

Pogz (Myc-DDK-tagged ORF) - Rat pogo transposable element with ZNF domain (Pogz), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POGZ Rabbit Polyclonal Antibody
TA343769

USD 410.00

5 Days

Rabbit Polyclonal Anti-POGZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the N terminal of human POGZ. Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA
POGZ Rabbit Polyclonal Antibody
TA343770

USD 475.00

5 Days

Rabbit Polyclonal Anti-POGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the C terminal of human POGZ. Synthetic peptide located within the following region: ASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF
POGZ (NM_145796) Human Recombinant Protein
TP710311

USD 425.00

In Stock

Purified recombinant protein of Human pogo transposable element with ZNF domain (POGZ), transcript variant 3, full length, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9
Pogz Rabbit Polyclonal Antibody
TA319377

USD 530.00

5 Days

Rabbit polyclonal anti-Pogz antibody

Applications WB
Reactivities Human, Dog, Short-tailed Opossum, Bovine, Rat, Chimpanzee, Macaque, Olive Baboon, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of mouse Pogz protein.
POGZ Rabbit Polyclonal Antibody
TA331640

USD 375.00

5 Days

Rabbit Polyclonal Anti-POGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POGZ Antibody: synthetic peptide directed towards the middle region of human POGZ. Synthetic peptide located within the following region: STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT