Products

cDNA Clones (41)
Proteins (28)
Antibodies (12)
RNAi (12)
Gene Expression (7)
Jump to Filters
View as table Download
POLR3H (NM_138338) Human Tagged ORF Clone
RC220534

USD 420.00

In Stock

POLR3H (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR3H (NM_001018052) Human Tagged ORF Clone
RC205709

USD 98.00

USD 390.00

In Stock

POLR3H (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR3H (NM_001018050) Human Tagged ORF Clone
RC210633

USD 98.00

USD 390.00

In Stock

POLR3H (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Polr3h (NM_030229) Mouse Tagged ORF Clone
MR202131

USD 68.00

USD 149.00

In Stock

Polr3h (Myc-DDK-tagged) - Mouse polymerase (RNA) III (DNA directed) polypeptide H (Polr3h)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001282884) Human Tagged ORF Clone
RC236539

USD 420.00

In Stock

POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001282885) Human Tagged ORF Clone
RC236540

USD 420.00

In Stock

POLR3H (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_001018052) Human Tagged ORF Clone
RG205709

USD 460.00

In Stock

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H (NM_138338) Human Tagged ORF Clone
RG220534

USD 460.00

In Stock

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3H Human Gene Knockout Kit (CRISPR)
KN405709

USD 1,290.00

2 Weeks

POLR3H - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405709 is the updated version of KN205709.
Polr3h Mouse Gene Knockout Kit (CRISPR)
KN513618

USD 1,290.00

2 Weeks

Polr3h - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513618 is the updated version of KN313618.
Polr3h (NM_030229) Mouse Tagged ORF Clone
MG202131

USD 300.00

3 Weeks

Polr3h (GFP-tagged) - Mouse polymerase (RNA) III (DNA directed) polypeptide H (Polr3h)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Polr3h (NM_030229) Mouse Tagged ORF Clone
MR202131L3

USD 500.00

3 Weeks

Lenti ORF clone of Polr3h (Myc-DDK-tagged) - Mouse polymerase (RNA) III (DNA directed) polypeptide H (Polr3h)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Polr3h (NM_030229) Mouse Tagged ORF Clone Lentiviral Particle
MR202131L3V

USD 700.00

6 Weeks

Lenti ORF particles, Polr3h (Myc-DDK-tagged) - Mouse polymerase (RNA) III (DNA directed) polypeptide H (Polr3h), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Polr3h (NM_030229) Mouse Tagged ORF Clone
MR202131L4

USD 500.00

3 Weeks

Lenti ORF clone of Polr3h (mGFP-tagged) - Mouse polymerase (RNA) III (DNA directed) polypeptide H (Polr3h)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Polr3h (NM_030229) Mouse Tagged ORF Clone Lentiviral Particle
MR202131L4V

USD 700.00

6 Weeks

Lenti ORF particles, Polr3h (GFP-tagged) - Mouse polymerase (RNA) III (DNA directed) polypeptide H (Polr3h), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone
RC205709L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone Lentiviral Particle
RC205709L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone
RC205709L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018052) Human Tagged ORF Clone Lentiviral Particle
RC205709L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone
RC210633L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone Lentiviral Particle
RC210633L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone
RC210633L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone Lentiviral Particle
RC210633L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone
RC220534L3

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone Lentiviral Particle
RC220534L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone
RC220534L4

USD 620.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_138338) Human Tagged ORF Clone Lentiviral Particle
RC220534L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR3H (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H (NM_001018050) Human Tagged ORF Clone
RG210633

USD 460.00

3 Weeks

POLR3H (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Polr3h (NM_001127295) Rat Tagged ORF Clone
RR203346

USD 420.00

4 Weeks

Polr3h (Myc-DDK-tagged ORF) - Rat polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (Polr3h), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Polr3h (NM_001127295) Rat Tagged ORF Clone
RR203346L3

USD 640.00

8 Weeks

Lenti ORF clone of Polr3h (Myc-DDK-tagged ORF) - Rat polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (Polr3h), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Polr3h (NM_001127295) Rat Tagged ORF Clone Lentiviral Particle
RR203346L3V

USD 850.00

12 Weeks

Lenti ORF particles, Polr3h (Myc-DDK-tagged ORF) - Rat polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (Polr3h), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Polr3h (NM_001127295) Rat Tagged ORF Clone
RR203346L4

USD 700.00

8 Weeks

Lenti ORF clone of Polr3h (mGFP-tagged ORF) - Rat polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (Polr3h), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Polr3h (NM_001127295) Rat Tagged ORF Clone Lentiviral Particle
RR203346L4V

USD 960.00

12 Weeks

Lenti ORF particles, Polr3h (GFP-tagged ORF) - Rat polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (Polr3h), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3H Rabbit Polyclonal Antibody
TA346687

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
POLR3H Rabbit Polyclonal Antibody
TA316209

USD 345.00

In Stock

Rabbit polyclonal anti-POLR3H (RPC8) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC8.
POLR3H (NM_001018050) Human Over-expression Lysate
LC422705

USD 121.00

In Stock

POLR3H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (NM_138338) Human Over-expression Lysate
LY408616

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3H (BC017248) Human Untagged Clone
SC106278

USD 310.00

In Stock

POLR3H (untagged)-Homo sapiens, clone MGC:29654 IMAGE:4892259, complete cds

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
POLR3H (NM_138338) Human Untagged Clone
SC111545

USD 420.00

In Stock

POLR3H (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
POLR3H (NM_001018050) Human Untagged Clone
SC323888

USD 420.00

In Stock

POLR3H (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
POLR3H (1-204, His-tag) Human Protein
AR50579PU-N

USD 845.00

2 Weeks

POLR3H (1-204, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
POLR3H (1-204, His-tag) Human Protein
AR50579PU-S

USD 330.00

2 Weeks

POLR3H (1-204, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]
CF809432

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI4D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI5A12]
CF809442

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI5A12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human POLR3H activation kit by CRISPRa
GA116248

USD 1,290.00

2 Weeks

POLR3H CRISPRa kit - CRISPR gene activation of human RNA polymerase III subunit H

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
POLR3H Human qPCR Template Standard (BC017248)
HK200314

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene POLR3H

Application Plasmid of exact quantity for transcript copy number calculation
POLR3H Human qPCR Template Standard (NM_138338)
HK211646

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene POLR3H

Application Plasmid of exact quantity for transcript copy number calculation
POLR3H Human qPCR Primer Pair (NM_001018050)
HP202608

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene POLR3H

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
POLR3H (NM_138338) Human Over-expression Lysate
LC408616

USD 121.00

2 Weeks

POLR3H HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB