Products

cDNA Clones (42)
Proteins (12)
RNAi (12)
Gene Expression (8)
Antibodies (5)
Jump to Filters
View as table Download
RPL9 (NM_000661) Human Tagged ORF Clone
RC205769

USD 98.00

USD 390.00

In Stock

RPL9 (Myc-DDK-tagged)-Human ribosomal protein L9 (RPL9), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPL9 (NM_001024921) Human Tagged ORF Clone
RC210735

USD 98.00

USD 390.00

In Stock

RPL9 (Myc-DDK-tagged)-Human ribosomal protein L9 (RPL9), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rpl9 (BC013165) Mouse Tagged ORF Clone
MR201845

USD 68.00

USD 310.00

In Stock

Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:6543 IMAGE:2655358)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (BC083166) Mouse Tagged ORF Clone
MR201848

USD 68.00

USD 310.00

In Stock

Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:102393 IMAGE:6397429)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (NM_011292) Mouse Tagged ORF Clone
MR216947

USD 200.00

In Stock

Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (Rpl9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL9 (NM_000661) Human Tagged ORF Clone
RG205769

USD 460.00

In Stock

RPL9 (GFP-tagged) - Human ribosomal protein L9 (RPL9), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL9 Human Gene Knockout Kit (CRISPR)
KN405769

USD 1,290.00

2 Weeks

RPL9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405769 is the updated version of KN205769.
Rpl9 Mouse Gene Knockout Kit (CRISPR)
KN515059

USD 1,290.00

2 Weeks

Rpl9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515059 is the updated version of KN315059.
Rpl9 (BC013165) Mouse Tagged ORF Clone
MG201845

USD 300.00

3 Weeks

Rpl9 (GFP-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:6543 IMAGE:2655358)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (BC083166) Mouse Tagged ORF Clone
MG201848

USD 300.00

3 Weeks

Rpl9 (GFP-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:102393 IMAGE:6397429)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (NM_011292) Mouse Tagged ORF Clone
MG216947

USD 220.00

3 Weeks

Rpl9 (GFP-tagged) - Mouse ribosomal protein L9 (Rpl9), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (BC013165) Mouse Tagged ORF Clone
MR201845L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:6543 IMAGE:2655358)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC013165) Mouse Tagged ORF Clone Lentiviral Particle
MR201845L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:6543 IMAGE:2655358), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC013165) Mouse Tagged ORF Clone
MR201845L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl9 (mGFP-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:6543 IMAGE:2655358)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC013165) Mouse Tagged ORF Clone Lentiviral Particle
MR201845L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl9 (GFP-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:6543 IMAGE:2655358), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC083166) Mouse Tagged ORF Clone
MR201848L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:102393 IMAGE:6397429)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC083166) Mouse Tagged ORF Clone Lentiviral Particle
MR201848L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:102393 IMAGE:6397429), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC083166) Mouse Tagged ORF Clone
MR201848L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl9 (mGFP-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:102393 IMAGE:6397429)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (BC083166) Mouse Tagged ORF Clone Lentiviral Particle
MR201848L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl9 (GFP-tagged) - Mouse ribosomal protein L9 (cDNA clone MGC:102393 IMAGE:6397429), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (NM_011292) Mouse Tagged ORF Clone
MR216947L3

USD 400.00

3 Weeks

Lenti ORF clone of Rpl9 (Myc-DDK-tagged) - Mouse ribosomal protein L9 (Rpl9)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (NM_011292) Mouse Tagged ORF Clone
MR216947L4

USD 400.00

3 Weeks

Lenti ORF clone of Rpl9 (mGFP-tagged) - Mouse ribosomal protein L9 (Rpl9)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_000661) Human Tagged ORF Clone
RC205769L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L9 (RPL9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_000661) Human Tagged ORF Clone Lentiviral Particle
RC205769L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPL9 (Myc-DDK tagged) - Human ribosomal protein L9 (RPL9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_000661) Human Tagged ORF Clone
RC205769L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L9 (RPL9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_000661) Human Tagged ORF Clone Lentiviral Particle
RC205769L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPL9 (mGFP-tagged) - Human ribosomal protein L9 (RPL9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_001024921) Human Tagged ORF Clone
RC210735L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L9 (RPL9), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_001024921) Human Tagged ORF Clone Lentiviral Particle
RC210735L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPL9 (Myc-DDK tagged) - Human ribosomal protein L9 (RPL9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_001024921) Human Tagged ORF Clone
RC210735L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L9 (RPL9), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_001024921) Human Tagged ORF Clone Lentiviral Particle
RC210735L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPL9 (mGFP-tagged) - Human ribosomal protein L9 (RPL9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 (NM_001024921) Human Tagged ORF Clone
RG210735

USD 460.00

3 Weeks

RPL9 (GFP-tagged) - Human ribosomal protein L9 (RPL9), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (NM_001007598) Rat Tagged ORF Clone
RR214831

USD 420.00

4 Weeks

Rpl9 (Myc-DDK-tagged ORF) - Rat ribosomal protein L9 (Rpl9), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl9 (NM_001007598) Rat Tagged ORF Clone
RR214831L3

USD 640.00

8 Weeks

Lenti ORF clone of Rpl9 (Myc-DDK-tagged ORF) - Rat ribosomal protein L9 (Rpl9), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl9 (NM_001007598) Rat Tagged ORF Clone
RR214831L4

USD 700.00

8 Weeks

Lenti ORF clone of Rpl9 (mGFP-tagged ORF) - Rat ribosomal protein L9 (Rpl9), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL9 Rabbit Polyclonal Antibody
TA345685

USD 410.00

5 Days

Rabbit Polyclonal Anti-RPL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY
RPL9 Rabbit Polyclonal Antibody
TA345686

USD 410.00

5 Days

Rabbit Polyclonal Anti-RPL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Rpl9 (NM_011292) Mouse Untagged Clone
MC202757

USD 210.00

In Stock

Rpl9 (untagged) - Mouse ribosomal protein L9 (Rpl9), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
RPL9 (NM_000661) Human Untagged Clone
SC119747

USD 310.00

In Stock

RPL9 (untagged)-Human ribosomal protein L9 (RPL9), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL9 (C-term) Rabbit Polyclonal Antibody
AP53724PU-N

USD 450.00

2 Weeks

RPL9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 148-177 amino acids from the C-terminal region of Human RPL9
Human RPL9 activation kit by CRISPRa
GA104151

USD 1,290.00

2 Weeks

RPL9 CRISPRa kit - CRISPR gene activation of human ribosomal protein L9

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rpl9 activation kit by CRISPRa
GA203696

USD 1,290.00

2 Weeks

Rpl9 CRISPRa kit - CRISPR gene activation of mouse ribosomal protein L9

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
RPL9 Human qPCR Template Standard (NM_000661)
HK206415

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RPL9

Application Plasmid of exact quantity for transcript copy number calculation
RPL9 Human qPCR Primer Pair (NM_001024921)
HP231380

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene RPL9

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
RPL9 (NM_001024921) Human Over-expression Lysate
LC422552

USD 121.00

2 Weeks

RPL9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL9 (NM_000661) Human Over-expression Lysate
LC424587

USD 121.00

2 Weeks

RPL9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL9 (NM_001024921) Human Over-expression Lysate
LC425468

USD 121.00

2 Weeks

RPL9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL9 (NM_001024921) Human Over-expression Lysate
LY422552

USD 396.00

5 Days

Transient overexpression lysate of ribosomal protein L9 (RPL9), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY422552 is the same product as LY425468.