STK17A (Myc-DDK-tagged)-Human serine/threonine kinase 17a (STK17A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
STK17A (Myc-DDK-tagged)-Human serine/threonine kinase 17a (STK17A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, STK17A (Myc-DDK tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, STK17A (mGFP-tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
STK17A (GFP-tagged) - Human serine/threonine kinase 17a (STK17A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
STK17A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, STK17A (Myc-DDK tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, STK17A (mGFP-tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
STK17A (untagged)-Human serine/threonine kinase 17a (STK17A)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
STK17A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human STK17A |
DRAK1 (STK17A) (301-414) mouse monoclonal antibody, clone 4D12, Purified
Applications | ELISA, IHC, RNAi, WB |
Reactivities | Human |
STK17A (untagged)-Kinase deficient mutant (K90M) of Human serine/threonine kinase 17a (STK17A)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-STK17A Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STK17A antibody is: synthetic peptide directed towards the C-terminal region of Human STK17A. Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE |
Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
STK17A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal DRAK1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DRAK1 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human DRAK1. |
Rabbit polyclonal antibody to DRAK1 (serine/threonine kinase 17a)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 231 of DRAK1 (Uniprot ID#Q9UEE5) |
STK17A - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
Format | Retroviral plasmids |
Vector | pRFP-C-RS |
STK17A - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Transient overexpression lysate of serine/threonine kinase 17a (STK17A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-STK17A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE |
STK17A - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
STK17A / DRAK1 (His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
STK17A / DRAK1 (His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
STK17A CRISPRa kit - CRISPR gene activation of human serine/threonine kinase 17a
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene STK17A
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene STK17A
Rabbit Polyclonal Anti-STK17A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human STK17A |
Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded controls for ICC/IHC staining
STK17A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack