Products

View as table Download

STK17A (Myc-DDK-tagged)-Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

STK17A (GFP-tagged) - Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

STK17A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN408265 is the updated version of KN208265.

Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

STK17A (untagged)-Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

STK17A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK17A

STK17A (untagged)-Kinase deficient mutant (K90M) of Human serine/threonine kinase 17a (STK17A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-STK17A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK17A antibody is: synthetic peptide directed towards the C-terminal region of Human STK17A. Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE

Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

STK17A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal DRAK1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DRAK1 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human DRAK1.

Rabbit polyclonal antibody to DRAK1 (serine/threonine kinase 17a)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 231 of DRAK1 (Uniprot ID#Q9UEE5)

STK17A - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS

STK17A - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti

Rabbit Polyclonal Anti-STK17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE

STK17A - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

STK17A / DRAK1 (His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

STK17A / DRAK1 (His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

STK17A CRISPRa kit - CRISPR gene activation of human serine/threonine kinase 17a

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene STK17A

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene STK17A

Rabbit Polyclonal Anti-STK17A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK17A

Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STK17A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS

Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack