Germany
Japan
United Kingdom
China
STK17A (Myc-DDK-tagged)-Human serine/threonine kinase 17a (STK17A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, STK17A (Myc-DDK tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, STK17A (mGFP-tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
STK17A (GFP-tagged) - Human serine/threonine kinase 17a (STK17A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
STK17A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408265 is the updated version of KN208265.
Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, STK17A (Myc-DDK tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, STK17A (mGFP-tagged) - Human serine/threonine kinase 17a (STK17A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
STK17A (untagged)-Human serine/threonine kinase 17a (STK17A)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
STK17A (untagged)-Kinase deficient mutant (K90M) of Human serine/threonine kinase 17a (STK17A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-STK17A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STK17A antibody is: synthetic peptide directed towards the C-terminal region of Human STK17A. Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE |
Lenti ORF clone of Human serine/threonine kinase 17a (STK17A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
STK17A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
STK17A - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
STK17A - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Transient overexpression lysate of serine/threonine kinase 17a (STK17A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-STK17A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE |
STK17A - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
STK17A / DRAK1 (His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
STK17A / DRAK1 (His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
STK17A CRISPRa kit - CRISPR gene activation of human serine/threonine kinase 17a
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene STK17A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene STK17A
Rabbit Polyclonal Anti-STK17A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human STK17A |
Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded controls for ICC/IHC staining
STK17A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of STK17A (NM_004760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- STK17A