Products

cDNA Clones (62)
Proteins (17)
RNAi (15)
Antibodies (14)
Gene Expression (6)
Jump to Filters
View as table Download
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L2V

USD 1,020.00

In Stock

Lenti ORF particles, TFEB (mGFP-tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, TFEB (mGFP-tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_011549) Mouse Tagged ORF Clone
MR223016

USD 560.00

In Stock

Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Tagged ORF Clone
RG207153

USD 460.00

In Stock

TFEB (GFP-tagged) - Human transcription factor EB (TFEB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Tagged ORF Clone
RC207153

USD 420.00

In Stock

TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Untagged Clone
SC122773

USD 310.00

In Stock

TFEB (untagged)-Human transcription factor EB (TFEB), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Tfeb (NM_001161722) Mouse Tagged ORF Clone
MR223018

USD 500.00

In Stock

Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_007162) Human Recombinant Protein
TP760282

USD 215.00

In Stock

Recombinant protein of human transcription factor EB (TFEB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
Tfeb (NM_011549) Mouse Tagged ORF Clone Lentiviral Particle
MR223016L1V

USD 960.00

6 Weeks

Lenti ORF particles, Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Tfeb (NM_011549) Mouse Tagged ORF Clone Lentiviral Particle
MR223016L2V

USD 960.00

3 Weeks

Lenti ORF particles, Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L1V

USD 820.00

6 Weeks

Lenti ORF particles, TFEB (Myc-DDK tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L1V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L2V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Tfeb (NM_011549) Mouse Tagged ORF Clone
MG223016

USD 620.00

In Stock

Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tfeb (NM_011549) Mouse Tagged ORF Clone
MR223016L4

USD 760.00

In Stock

Lenti ORF clone of Tfeb (mGFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone
RG230141

USD 460.00

In Stock

TFEB (GFP-tagged) - Human transcription factor EB (TFEB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tfeb (NM_001161722) Mouse Tagged ORF Clone
MG223018

USD 550.00

In Stock

Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001167827) Human Tagged ORF Clone
RC230141

USD 420.00

In Stock

TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tfeb (NM_001025707) Rat Tagged ORF Clone
RR213134

USD 814.00

In Stock

Tfeb (Myc-DDK-tagged ORF) - Rat transcription factor EB (Tfeb), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tfeb (NM_001161723) Mouse Tagged ORF Clone
MG208563

USD 550.00

5 Weeks

Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tfeb (NM_001161723) Mouse Tagged ORF Clone
MR208563

USD 500.00

5 Weeks

Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271944) Human Tagged ORF Clone
RC234213

USD 420.00

In Stock

TFEB (Myc-DDK tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271945) Human Tagged ORF Clone
RC234214

USD 420.00

In Stock

TFEB (Myc-DDK tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001167827) Human Tagged ORF Clone
RC230141L4

USD 620.00

In Stock

Lenti-ORF clone of TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001271944) Human Tagged ORF Clone
RG234213

USD 460.00

2 Weeks

TFEB (GFP-tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB Human Gene Knockout Kit (CRISPR)
KN407153

USD 1,290.00

2 Weeks

TFEB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407153 is the updated version of KN207153.
Tfeb (NM_001161723) Mouse Tagged ORF Clone
MR208563L3

USD 700.00

3 Weeks

Lenti ORF clone of Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_001161723) Mouse Tagged ORF Clone Lentiviral Particle
MR208563L3V

USD 900.00

6 Weeks

Lenti ORF particles, Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_001161723) Mouse Tagged ORF Clone Lentiviral Particle
MR208563L4V

USD 900.00

6 Weeks

Lenti ORF particles, Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_011549) Mouse Tagged ORF Clone Lentiviral Particle
MR223016L3V

USD 960.00

2 Weeks

Lenti ORF particles, Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_011549) Mouse Tagged ORF Clone Lentiviral Particle
MR223016L4V

USD 960.00

3 Weeks

Lenti ORF particles, Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_001161722) Mouse Tagged ORF Clone
MR223018L3

USD 700.00

3 Weeks

Lenti ORF clone of Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tfeb (NM_001161722) Mouse Tagged ORF Clone Lentiviral Particle
MR223018L3V

USD 900.00

6 Weeks

Lenti ORF particles, Tfeb (Myc-DDK-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_007162) Human Tagged ORF Clone Lentiviral Particle
RC207153L3V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (Myc-DDK tagged) - Human transcription factor EB (TFEB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L3V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001167827) Human Tagged ORF Clone Lentiviral Particle
RC230141L4V

USD 820.00

3 Weeks

Lenti ORF particles, TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001271943) Human Tagged ORF Clone
RC233963

USD 420.00

5 Weeks

TFEB (Myc-DDK tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271943) Human Tagged ORF Clone
RG233963

USD 460.00

5 Weeks

TFEB (GFP-tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB (NM_001271945) Human Tagged ORF Clone
RG234214

USD 460.00

3 Weeks

TFEB (GFP-tagged) - Homo sapiens transcription factor EB (TFEB), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFEB Human shRNA Plasmid Kit (Locus ID 7942)
TR308867

USD 715.00

In Stock

TFEB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
TFEB (NM_007162) Human Tagged Lenti ORF Clone
RC207153L2

USD 768.00

In Stock

Lenti ORF clone of Human transcription factor EB (TFEB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Tfeb (NM_001161722) Mouse Tagged ORF Clone Lentiviral Particle
MR223018L4V

USD 1,116.00

3 Weeks

Lenti ORF particles, Tfeb (GFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFEB (NM_001167827) Human Tagged Lenti ORF Clone
RC230141L2

USD 768.00

In Stock

Lenti-ORF clone of TFEB (mGFP-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFEB Rabbit Polyclonal Antibody
TA344452

USD 475.00

5 Days

Rabbit Polyclonal Anti-TFEB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
Tfeb (NM_011549) Mouse Tagged Lenti ORF Clone
MR223016L2

USD 936.00

In Stock

Lenti ORF clone of Tfeb (mGFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFEB (NM_001167827) Human Tagged Lenti ORF Clone
RC230141L1

USD 768.00

In Stock

Lenti-ORF clone of TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Tfeb (NM_001161722) Mouse Tagged ORF Clone
MR223018L4

USD 864.00

In Stock

Lenti ORF clone of Tfeb (mGFP-tagged) - Mouse transcription factor EB (Tcfeb), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®