Products

cDNA Clones (42)
Proteins (15)
RNAi (12)
Antibodies (9)
Gene Expression (8)
Jump to Filters
View as table Download
TRIM14 (NM_014788) Human Tagged ORF Clone
RC214697

USD 420.00

In Stock

TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TRIM14 (NM_033219) Human Tagged ORF Clone
RC202831

USD 420.00

In Stock

TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TRIM14 (NM_033220) Human Tagged ORF Clone
RC213915

USD 460.00

In Stock

TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Trim14 (NM_029077) Mouse Tagged ORF Clone
MR224121

USD 350.00

In Stock

Trim14 (Myc-DDK-tagged) - Mouse tripartite motif-containing 14 (Trim14)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TRIM14 (NM_014788) Human Tagged ORF Clone Lentiviral Particle
RC214697L1V

USD 820.00

3 Weeks

Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TRIM14 (NM_014788) Human Tagged ORF Clone Lentiviral Particle
RC214697L2V

USD 820.00

6 Weeks

Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TRIM14 Human Gene Knockout Kit (CRISPR)
KN402831

USD 1,290.00

2 Weeks

TRIM14 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402831 is the updated version of KN202831.
Trim14 Mouse Gene Knockout Kit (CRISPR)
KN518185

USD 1,290.00

2 Weeks

Trim14 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN518185 is the updated version of KN318185.
Trim14 (NM_029077) Mouse Tagged ORF Clone
MG224121

USD 390.00

3 Weeks

Trim14 (GFP-tagged) - Mouse tripartite motif-containing 14 (Trim14), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Trim14 (NM_029077) Mouse Tagged ORF Clone
MR224121L3

USD 550.00

3 Weeks

Lenti ORF clone of Trim14 (Myc-DDK-tagged) - Mouse tripartite motif-containing 14 (Trim14)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trim14 (NM_029077) Mouse Tagged ORF Clone
MR224121L4

USD 550.00

3 Weeks

Lenti ORF clone of Trim14 (mGFP-tagged) - Mouse tripartite motif-containing 14 (Trim14)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trim14 (NM_029077) Mouse Tagged ORF Clone Lentiviral Particle
MR224121L4V

USD 750.00

6 Weeks

Lenti ORF particles, Trim14 (GFP-tagged) - Mouse tripartite motif-containing 14 (Trim14), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033219) Human Tagged ORF Clone
RC202831L3

USD 620.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033219) Human Tagged ORF Clone Lentiviral Particle
RC202831L3V

USD 820.00

6 Weeks

Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033219) Human Tagged ORF Clone
RC202831L4

USD 620.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033219) Human Tagged ORF Clone Lentiviral Particle
RC202831L4V

USD 820.00

6 Weeks

Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033220) Human Tagged ORF Clone
RC213915L3

USD 660.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033220) Human Tagged ORF Clone Lentiviral Particle
RC213915L3V

USD 860.00

6 Weeks

Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033220) Human Tagged ORF Clone
RC213915L4

USD 660.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033220) Human Tagged ORF Clone Lentiviral Particle
RC213915L4V

USD 860.00

6 Weeks

Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_014788) Human Tagged ORF Clone
RC214697L3

USD 620.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_014788) Human Tagged ORF Clone Lentiviral Particle
RC214697L3V

USD 820.00

5 Weeks

Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_014788) Human Tagged ORF Clone
RC214697L4

USD 620.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_014788) Human Tagged ORF Clone Lentiviral Particle
RC214697L4V

USD 820.00

7 Weeks

Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_033219) Human Tagged ORF Clone
RG202831

USD 460.00

3 Weeks

TRIM14 (GFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TRIM14 (NM_033220) Human Tagged ORF Clone
RG213915

USD 510.00

3 Weeks

TRIM14 (GFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TRIM14 (NM_014788) Human Tagged ORF Clone
RG214697

USD 460.00

3 Weeks

TRIM14 (GFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Trim14 (NM_001107934) Rat Tagged ORF Clone
RR209523

USD 420.00

4 Weeks

Trim14 (Myc-DDK-tagged ORF) - Rat tripartite motif protein 14 (Trim14), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Trim14 (NM_001107934) Rat Tagged ORF Clone
RR209523L3

USD 640.00

9 Weeks

Lenti ORF clone of Trim14 (Myc-DDK-tagged ORF) - Rat tripartite motif protein 14 (Trim14), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trim14 (NM_001107934) Rat Tagged ORF Clone
RR209523L4

USD 700.00

9 Weeks

Lenti ORF clone of Trim14 (mGFP-tagged ORF) - Rat tripartite motif protein 14 (Trim14), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRIM14 (NM_014788) Human Tagged ORF Clone
RC214697L1

USD 768.00

In Stock

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TRIM14 Rabbit Polyclonal Antibody
TA345475

USD 475.00

5 Days

Rabbit Polyclonal Anti-TRIM14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNR
TRIM14 (NM_014788) Human Tagged ORF Clone
RC214697L2

USD 620.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TRIM14 (NM_014788) Human Untagged Clone
SC114889

USD 760.00

In Stock

TRIM14 (untagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TRIM14 (AK097480) Human Untagged Clone
SC105060

USD 660.00

In Stock

(untagged)-Human cDNA FLJ40161 fis, clone TESTI2015710

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TRIM14 (NM_033219) Human Untagged Clone
SC320764

USD 760.00

In Stock

TRIM14 (untagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TRIM14 (NM_014788) Human Over-expression Lysate
LY415001

USD 605.00

5 Days

Transient overexpression lysate of tripartite motif-containing 14 (TRIM14), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TRIM14 Rabbit Polyclonal Antibody
TA337948

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIM14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP
TRIM14 Rabbit Polyclonal Antibody
TA338077

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIM14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: LVEAVESTLQTPLDIRLKESINCQLSDPSSTKPGTLLKTSPSPERSLLLK
TRIM14 Rabbit Polyclonal Antibody
TA338078

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIM14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the N terminal of human TRIM14. Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV
TRIM14 Rabbit Polyclonal Antibody
TA338079

USD 310.00

5 Days

Rabbit Polyclonal Anti-TRIM14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the N terminal of human TRIM14. Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV
Trim14 Mouse shRNA Plasmid (Locus ID 74735)
TR516000

USD 715.00

2 Weeks

Trim14 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Human TRIM14 activation kit by CRISPRa
GA106626

USD 1,290.00

2 Weeks

TRIM14 CRISPRa kit - CRISPR gene activation of human tripartite motif containing 14

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Trim14 activation kit by CRISPRa
GA210001

USD 1,290.00

2 Weeks

Trim14 CRISPRa kit - CRISPR gene activation of mouse tripartite motif-containing 14

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
TRIM14 Human qPCR Template Standard (NM_014788)
HK210258

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene TRIM14

Application Plasmid of exact quantity for transcript copy number calculation
TRIM14 Human qPCR Template Standard (NM_033219)
HK211459

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene TRIM14

Application Plasmid of exact quantity for transcript copy number calculation
TRIM14 Human qPCR Primer Pair (NM_033219)
HP226495

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene TRIM14