TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TRIM14 (Myc-DDK-tagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Trim14 (Myc-DDK-tagged) - Mouse tripartite motif-containing 14 (Trim14)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TRIM14 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Trim14 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Trim14 (GFP-tagged) - Mouse tripartite motif-containing 14 (Trim14), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Trim14 (Myc-DDK-tagged) - Mouse tripartite motif-containing 14 (Trim14)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Trim14 (Myc-DDK-tagged) - Mouse tripartite motif-containing 14 (Trim14), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Trim14 (mGFP-tagged) - Mouse tripartite motif-containing 14 (Trim14)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Trim14 (GFP-tagged) - Mouse tripartite motif-containing 14 (Trim14), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRIM14 (Myc-DDK tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRIM14 (mGFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TRIM14 (GFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TRIM14 (GFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TRIM14 (GFP-tagged) - Human tripartite motif containing 14 (TRIM14), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Trim14 (Myc-DDK-tagged ORF) - Rat tripartite motif protein 14 (Trim14), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Trim14 (Myc-DDK-tagged ORF) - Rat tripartite motif protein 14 (Trim14), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Trim14 (Myc-DDK-tagged ORF) - Rat tripartite motif protein 14 (Trim14), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Trim14 (mGFP-tagged ORF) - Rat tripartite motif protein 14 (Trim14), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Trim14 (GFP-tagged ORF) - Rat tripartite motif protein 14 (Trim14), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TRIM14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNR |
Lenti ORF clone of Human tripartite motif containing 14 (TRIM14), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TRIM14 (untagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
(untagged)-Human cDNA FLJ40161 fis, clone TESTI2015710
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
TRIM14 (untagged)-Human tripartite motif containing 14 (TRIM14), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of tripartite motif-containing 14 (TRIM14), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-TRIM14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP |
Rabbit Polyclonal Anti-TRIM14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: LVEAVESTLQTPLDIRLKESINCQLSDPSSTKPGTLLKTSPSPERSLLLK |
Rabbit Polyclonal Anti-TRIM14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the N terminal of human TRIM14. Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV |
Rabbit Polyclonal Anti-TRIM14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the N terminal of human TRIM14. Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV |
Trim14 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
TRIM14 CRISPRa kit - CRISPR gene activation of human tripartite motif containing 14
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Trim14 CRISPRa kit - CRISPR gene activation of mouse tripartite motif-containing 14
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TRIM14
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene TRIM14
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene TRIM14