Germany
Japan
United Kingdom
China
C10orf54 (Myc-DDK-tagged)-Human chromosome 10 open reading frame 54 (C10orf54)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human chromosome 10 open reading frame 54 (C10orf54)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, C10orf54 (Myc-DDK tagged) - Human chromosome 10 open reading frame 54 (C10orf54), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
C10orf54 (GFP-tagged) - Human chromosome 10 open reading frame 54 (C10orf54)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
4632428N05Rik (GFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, 4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, 4632428N05Rik (GFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
4632428N05Rik (GFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human chromosome 10 open reading frame 54 (C10orf54), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of 4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, 4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of 4632428N05Rik (mGFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, 4632428N05Rik (GFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of 4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, 4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, 4632428N05Rik (GFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chromosome 10 open reading frame 54 (C10orf54), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, C10orf54 (Myc-DDK tagged) - Human chromosome 10 open reading frame 54 (C10orf54), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, C10orf54 (mGFP-tagged) - Human chromosome 10 open reading frame 54 (C10orf54), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MGC112715 (Myc-DDK-tagged ORF) - Rat platelet receptor Gi24 (MGC112715), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of MGC112715 (Myc-DDK-tagged ORF) - Rat platelet receptor Gi24 (MGC112715), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MGC112715 (Myc-DDK-tagged ORF) - Rat platelet receptor Gi24 (MGC112715), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of MGC112715 (mGFP-tagged ORF) - Rat platelet receptor Gi24 (MGC112715), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MGC112715 (GFP-tagged ORF) - Rat platelet receptor Gi24 (MGC112715), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of 4632428N05Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of 4632428N05Rik (mGFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of chromosome 10 open reading frame 54 (C10orf54)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
4632428N05Rik (untagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chromosome 10 open reading frame 54 (C10orf54), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Vsir (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
VSIR - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
C10orf54 (untagged)-Human chromosome 10 open reading frame 54 (C10orf54)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Vsir - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Lenti ORF clone of 4632428N05Rik (mGFP-tagged) - Mouse RIKEN cDNA 4632428N05 gene (4632428N05Rik), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
C10orf54 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human B7H5 (B7H5), with C-terminal DDK/His tag, expressed in human cells
| Tag | C-DDK/His |
| Expression Host | HEK293 |
Purified recombinant protein of Human B7H5 (B7H5), with C-terminal Fc tag, expressed in human cells
| Tag | C-Fc |
| Expression Host | HEK293 |
qSTAR qPCR primer pairs against Mus musculus gene Vsir
Rabbit Polyclonal Anti-C10orf54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE |
Platelet receptor Gi24 (33-191, His-tag) mouse protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
Platelet receptor Gi24 (33-191, His-tag) mouse protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
Platelet receptor Gi24 (33-194, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
Platelet receptor Gi24 (33-194, His-tag) human protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
Active filters
Target Symbol
- VSIR
Filter by
Species
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Tags
Vectors
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)