Ccna2 Rabbit Polyclonal Antibody

CAT#: TA329127

Rabbit Polyclonal anti-Ccna2 antibody

Product Images

WB Suggested Anti-Ccna2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Rat Muscle

• 

  Ccna2 antibody - C-terminal region validated by WB using testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: cyclin A2
• Database Link:
  NP_446154
  Entrez Gene 890 HumanEntrez Gene 114494 Rat
• Background: The function of Ccna2 remains unknown.
• Synonyms: CCN1; CCNA; Cyclin-A
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Yeast: 82%; Zebrafish: 77%