Amphiregulin (AREG) Rabbit Polyclonal Antibody

CAT#: TA329139

Rabbit Polyclonal anti-AREG antibody

Product Images

WB Suggested Anti-AREG Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: amphiregulin
• Database Link:
  NP_001648
  Entrez Gene 374 Human
  UniProt ID P15514
• Background: The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype.
• Synonyms: AR; AREGB; CRDGF; SDGF
• Note: Immunogen sequence homology: Human: 100%; Dog: 91%; Pig: 91%; Horse: 91%; Sheep: 91%; Bovine: 91%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ErbB signaling pathway