MAP3K8 Rabbit Polyclonal Antibody

CAT#: TA329168

Rabbit Polyclonal anti-MAP3K8 antibody

Product Images

WB Suggested Anti-MAP3K8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the N terminal of human MAP3K8. Synthetic peptide located within the following region: ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: mitogen-activated protein kinase kinase kinase 8
• Database Link:
  NP_005195
  Entrez Gene 1326 Human
  UniProt ID P41279
• Background: This gene is an oncogene that encodes a member of the serine/threonine protein kinase family. The encoded protein localizes to the cytoplasm and can activate both the MAP kinase and JNK kinase pathways. This protein was shown to activate IkappaB kinases, and thus induce the nuclear production of NF-kappaB. This protein was also found to promote the production of TNF-alpha and IL-2 during T lymphocyte activation. This gene may also utilize a downstream in-frame translation start codon, and thus produce an isoform containing a shorter N-terminus. The shorter isoform has been shown to display weaker transforming activity. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]
• Synonyms: AURA2; c-COT; COT; EST; ESTF; MEKK8; Tpl-2; TPL2
• Note: Immunogen sequence homology: Human: 100%; Horse: 87%; Mouse: 85%; Bovine: 75%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway