Nfe2l1 Rabbit Polyclonal Antibody

CAT#: TA329218

Rabbit Polyclonal anti-Nfe2l1 Antibody

Product Images

Host: Rabbit; Target Name: Nfe2l1; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nfe2l1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2l1. Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: nuclear factor, erythroid derived 2,-like 1
• Database Link:
  NP_032712
  Entrez Gene 18023 Mouse
  UniProt ID Q61985
• Background: This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases from the use of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1.
• Synonyms: FLJ00380; HBZ17; LCR-F1; NRF1; TCF11
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%