Nuclear Factor Erythroid Derived 2 (NFE2) Rabbit Polyclonal Antibody

CAT#: TA329221

Rabbit Polyclonal anti-NFE2 antibody

Product Images

WB Suggested Anti-NFE2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFE2 antibody: synthetic peptide directed towards the N terminal of human NFE2. Synthetic peptide located within the following region: MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: nuclear factor, erythroid 2
• Database Link:
  NP_006154
  Entrez Gene 4778 Human
  UniProt ID Q16621
• Background: NFE2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. NFE2 binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. NFE2 is requires MAFK or other small MAF proteins for binding to the NF-E2 motif. NFE2 may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.
• Synonyms: NF-E2; p45
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Bovine: 92%; Pig: 87%; Horse: 87%; Guinea pig: 87%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors