ATF6 Rabbit Polyclonal Antibody

CAT#: TA329384

Rabbit Polyclonal anti-ATF6 antibody

Product Images

WB Suggested Anti-ATF6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysateATF6 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: activating transcription factor 6
• Database Link:
  NP_031374
  Entrez Gene 22926 Human
  UniProt ID P18850
• Background: ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-171 AB015856.1 2-172 172-265 BC014969.1 124-217 266-336 AB015856.1 267-337 337-650 BC014969.1 289-602 651-1294 AF005887.1 626-1269 1295-2406 AB015856.1 1296-2407 2407-2488 AF005887.1 2375-2456
• Synonyms: ACHM7; ATF6A
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Horse: 86%; Bovine: 86%; Dog: 79%; Rat: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Alzheimer's disease